Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.86
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.4e-03
atypical teratoid / rhabdoid tumor -1.100 9.7e-06
breast carcinoma -1.200 1.2e-04
group 4 medulloblastoma -1.200 4.1e-03
medulloblastoma, large-cell -1.100 3.0e-04
non-inflammatory breast cancer -1.200 2.7e-02
psoriasis -1.400 1.1e-42

Gene RIF (3)

AA Sequence

MEGPRSSTHVPLVLPLLVLLLLAPARQAAAQRCPQACICDNSRRHVACRYQNLTEVPDAIPELTQRLDLQ      1 - 70
GNLLKVIPAAAFQGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASNHLRELPQEALDGLGSLRRLE     71 - 140
LEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQGLLRVRWLRLSHNALSVLAPEALAGLPALRR    141 - 210
LSLHHNELQALPGPVLSQARGLARLELGHNPLTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRL    211 - 280
HTLDLRGNQLDTLPPLQGPGQLRRLRLQGNPLWCGCQARPLLEWLARARVRSDGACQGPRRLRGEALDAL    281 - 350
RPWDLRCPGDAAQEEEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVCVPESRHSSCEGCGLQAVP    351 - 420
RGFPSDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALAGLGRLIYLYLSDNQLAGLSA    421 - 490
AALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGDLGRTRALRWVYLSGNRITEV    491 - 560
SLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQLSGNPLRALRDGAFQPVGRSLQHLFLNSSGL    561 - 630
EQICPGAFSGLGPGLQSLHLQKNQLRALPALPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLRVGAT    631 - 700
CATPPNARGQRVKAAAAVFEDCPGWAARKAKRTPASRPSARRTPIKGRQCGADKVGKEKGRL            701 - 762
//

Text Mined References (8)

PMID Year Title