Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.218 4.0e-02
Breast cancer 1.400 7.3e-08
gastric cancer 1.100 8.1e-03
hepatocellular carcinoma 1.400 2.7e-04
interstitial cystitis 1.500 6.2e-03
medulloblastoma, large-cell 1.100 7.9e-03
non-small cell lung cancer 1.244 4.5e-11
pancreatic cancer 1.800 3.6e-02
pancreatic carcinoma 1.800 3.6e-02
pancreatic ductal adenocarcinoma liver m... -1.189 1.1e-02
primary Sjogren syndrome 1.200 2.3e-03
psoriasis 1.600 1.3e-29
tuberculosis and treatment for 3 months -1.500 2.0e-05

Gene RIF (1)

AA Sequence

MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG      1 - 70
KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR     71 - 140
NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI                              141 - 184
//

Text Mined References (6)

PMID Year Title