Property Summary

NCBI Gene PubMed Count 20
PubMed Score 31.14
PubTator Score 16.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 1.300 1.1e-06
cutaneous lupus erythematosus 1.900 3.5e-04
oligodendroglioma -1.200 1.0e-04
posterior fossa group A ependymoma 1.300 1.8e-03
astrocytoma 2.200 3.3e-02
Atopic dermatitis 1.500 7.0e-04
adrenocortical carcinoma -1.305 8.7e-05
tuberculosis and treatment for 3 months -1.500 1.0e-03
primary pancreatic ductal adenocarcinoma 1.175 3.7e-03
non-small cell lung cancer -1.656 8.0e-10
intraductal papillary-mucinous carcinoma... -3.100 3.1e-03
intraductal papillary-mucinous neoplasm ... -3.300 8.3e-03
lung cancer -3.500 6.8e-06
cystic fibrosis 2.500 9.6e-04
group 3 medulloblastoma -1.500 9.7e-03
pilocytic astrocytoma 2.200 1.6e-06
primary Sjogren syndrome 1.100 2.9e-04
aldosterone-producing adenoma -1.366 3.2e-02
psoriasis 1.400 3.4e-52
nasopharyngeal carcinoma -1.800 1.7e-05
non-inflammatory breast cancer -1.900 6.5e-04
lung carcinoma -1.200 1.8e-04
ductal carcinoma in situ 1.300 3.4e-02
ulcerative colitis 1.100 1.5e-03
pituitary cancer -1.700 6.0e-04
chronic rhinosinusitis -1.464 3.1e-02
pancreatic cancer 1.200 7.5e-03

Gene RIF (17)

PMID Text
26857497 Exome analysis in 212 multiple sclerosis and 14 neuromyelitis optica patients identified a rare CH25H p.Q17H mutation in two NMO patients of Asian ancestry. In addition, association analysis of common CH25H variants.
26469385 HIV-1 MA increases CH25H mRNA expression in HepG2 cells
25999047 Infection with HCV causes up-regulation of interferon-inducible CH25H in vivo.
25903345 These results demonstrate that CH25H constitutes a primary innate response against hepatitis C virus infection through regulating host lipid metabolism.
24667918 HIV-1 MA increases CH25H mRNA expression in HepG2 cells
20699362 Cholesterol 25-hydroxylase production by dendritic cells and macrophages is regulated by type I interferons.
20574532 Observational study of gene-disease association. (HuGE Navigator)
20535486 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
17373700 Observational study of gene-disease association. (HuGE Navigator)
16909003 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
16157450 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16157450 Based on the results of genome-wide screens, along with biological studies, we selected three genes as candidates for AD risk factors: ATP-binding cassette transporter A1 (ABCA1), cholesterol 25-hydroxylase (CH25H) and cholesterol 24-hydroxylase (CH24H).
15465627 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR      1 - 70
YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF     71 - 140
VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL    141 - 210
SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR            211 - 272
//

Text Mined References (21)

PMID Year Title
26857497 2016 Analysis of CH25H in multiple sclerosis and neuromyelitis optica.
25999047 2015 Interferon-inducible cholesterol-25-hydroxylase restricts hepatitis C virus replication through blockage of membranous web formation.
25903345 2015 Identification of Cholesterol 25-Hydroxylase as a Novel Host Restriction Factor and a Part of the Primary Innate Immune Responses against Hepatitis C Virus Infection.
21041692 2010 Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science.
20699362 2010 Cholesterol 25-hydroxylase production by dendritic cells and macrophages is regulated by type I interferons.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20535486 2010 Capillary cerebral amyloid angiopathy identifies a distinct APOE epsilon4-associated subtype of sporadic Alzheimer's disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
18830724 2009 Assessment of Alzheimer's disease case-control associations using family-based methods.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
16909003 2005 Cholesterol 25-hydroxylase on chromosome 10q is a susceptibility gene for sporadic Alzheimer's disease.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16157450 2006 Association studies of cholesterol metabolism genes (CH25H, ABCA1 and CH24H) in Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465627 Association analysis of genes involved in cholesterol metabolism located within the linkage region on chromosome 10 and Alzheimer's disease.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9852097 1998 cDNA cloning of mouse and human cholesterol 25-hydroxylases, polytopic membrane proteins that synthesize a potent oxysterol regulator of lipid metabolism.