Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.70
PubTator Score 6.33

Knowledge Summary


No data available


  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.300 1.4e-02
oligodendroglioma -1.100 4.9e-02
group 4 medulloblastoma -2.300 1.5e-06
medulloblastoma, large-cell -2.100 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.536 1.5e-02
non-small cell lung cancer -2.433 1.1e-22
intraductal papillary-mucinous adenoma (... -1.800 1.9e-04
intraductal papillary-mucinous carcinoma... -2.100 7.3e-04
intraductal papillary-mucinous neoplasm ... -2.600 9.0e-05
lung adenocarcinoma -3.000 2.7e-15
psoriasis -1.700 2.9e-09
subependymal giant cell astrocytoma 1.574 1.6e-02
inflammatory breast cancer -1.700 5.9e-03
lung carcinoma 1.100 8.5e-13
spina bifida -2.234 3.6e-02
Pick disease 1.200 1.8e-02
gastric carcinoma -1.800 5.0e-02
ovarian cancer -4.000 1.8e-18
pituitary cancer -2.300 2.5e-06
facioscapulohumeral dystrophy 2.000 1.4e-03

Gene RIF (5)

24807907 MgcRacGAP colocalizes with CGN and CGNL1 at TJs and forms a complex and interacts directly in vitro with CGN and CGNL1.
24163246 Results indentify plausible candidates include non-recurrent deletions at the glutamate transporter gene SLC1A1, a CNV locus recently suggested to be involved in schizophrenia through linkage analysis, and duplications at 1p36.33 and CGNL1.
21454477 ZO-1 and PLEKHA7 are paracingulin-interacting proteins that are involved in its recruitment to epithelial tight and adherens junctions, respectively
18653465 Paracingulin regulates the activity of Rac1 and RhoA GTPases by recruiting Tiam1 and GEF-H1 to epithelial junctions
15292197 This paper studied the mouse JACOP protein and found that the JACOP protein has structural and functional similarities to cingulin.

AA Sequence

KLPSKVLDDMDDDDDLSTDGGSLYEAPVSYTFSKDSTVASQI                               1261 - 1302

Text Mined References (16)

PMID Year Title
24807907 2014 MgcRacGAP interacts with cingulin and paracingulin to regulate Rac1 activation and development of the tight junction barrier during epithelial junction assembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163246 2014 CNV analysis in a large schizophrenia sample implicates deletions at 16p12.1 and SLC1A1 and duplications at 1p36.33 and CGNL1.
22315225 2012 Distinct domains of paracingulin are involved in its targeting to the actin cytoskeleton and regulation of apical junction assembly.
21454477 2011 A role for ZO-1 and PLEKHA7 in recruiting paracingulin to tight and adherens junctions of epithelial cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21305692 2011 Genome-wide association analysis of age at onset and psychotic symptoms in bipolar disorder.
18653465 2008 Paracingulin regulates the activity of Rac1 and RhoA GTPases by recruiting Tiam1 and GEF-H1 to epithelial junctions.
17584767 2007 Regional rearrangements in chromosome 15q21 cause formation of cryptic promoters for the CYP19 (aromatase) gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292197 2004 JACOP, a novel plaque protein localizing at the apical junctional complex with sequence similarity to cingulin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12736278 2003 Estrogen excess associated with novel gain-of-function mutations affecting the aromatase gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.