Property Summary

NCBI Gene PubMed Count 12
PubMed Score 110.94
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

AA Sequence

MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP      1 - 70
ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS     71 - 140
SKAPPPSLPSPSRLPGPSDTPILPQ                                                 141 - 165
//

Text Mined References (25)

PMID Year Title
16123088 2005 Expression of beta-subunit of HCG genes during normal and failed pregnancy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11861891 2002 Chorionic gonadotropin has a recent origin within primates and an evolutionary history of selection.
9012484 1997 Malignant transformation of nontrophoblastic cells is associated with the expression of chorionic gonadotropin beta genes normally transcribed in trophoblastic cells.
8202136 1994 Crystal structure of human chorionic gonadotropin.
7462224 1981 The amino acid sequences of the prepeptides contained in the alpha and beta subunits of human choriogonadotropin.
7240231 1981 Assignment of disulfide bonds in the beta subunit of human chorionic gonadotropin.
6774259 1980 The cDNA for the beta-subunit of human chorionic gonadotropin suggests evolution of a gene by readthrough into the 3'-untranslated region.
6690982 1984 Evolution of the genes for the beta subunits of human chorionic gonadotropin and luteinizing hormone.
6319099 1983 The human genome contains seven genes for the beta-subunit of chorionic gonadotropin but only one gene for the beta-subunit of luteinizing hormone.
6209613 1984 Only three of the seven human chorionic gonadotropin beta subunit genes can be expressed in the placenta.
6204923 1984 The beta chorionic gonadotropin-beta luteinizing gene cluster maps to human chromosome 19.
6194155 1983 The beta subunit of human chorionic gonadotropin is encoded by multiple genes.
4795659 1973 Human chorionic gonadotropin. Linear amino acid sequence of the beta subunit.
2468994 1988 Isolation and characterization of the human chorionic gonadotropin beta subunit (CG beta) gene cluster: regulation of transcriptionally active CG beta gene by cyclic AMP.
2452822 1988 Identification of a promoter region in the CG beta gene cluster.
2424697 1986 Evolution of different transcriptional start sites in the human luteinizing hormone and chorionic gonadotropin beta-subunit genes.
2422163 1986 A map of the hCG beta-LH beta gene cluster.
1820200 1991 Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy.
1688430 1990 Role of disulfide bond formation in the folding of human chorionic gonadotropin beta subunit into an alpha beta dimer assembly-competent form.
1371113 1992 Identification of the transcriptionally active genes of the chorionic gonadotropin beta gene cluster in vivo.
1150658 1975 The amino acid sequence of human chorionic gonadotropin. The alpha subunit and beta subunit.