Property Summary

NCBI Gene PubMed Count 227
PubMed Score 2235.19
PubTator Score 2637.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical adenoma -1.658 9.3e-03
adrenocortical carcinoma -1.567 1.3e-03
adult high grade glioma -1.400 8.0e-03
aldosterone-producing adenoma -3.063 1.0e-02
astrocytic glioma -1.500 1.1e-03
Astrocytoma, Pilocytic -2.500 1.7e-08
atypical teratoid / rhabdoid tumor -2.300 2.7e-05
colon cancer -2.300 2.1e-02
ependymoma -1.900 5.9e-03
glioblastoma -1.800 1.4e-06
group 3 medulloblastoma 1.400 4.2e-02
intraductal papillary-mucinous carcinoma... -1.400 2.7e-02
intraductal papillary-mucinous neoplasm ... -1.700 1.2e-02
lung carcinoma 5.400 6.4e-68
oligodendroglioma -1.300 9.6e-10
ovarian cancer 1.200 6.2e-05
pancreatic cancer -1.100 3.3e-03
pituitary cancer 1.100 1.4e-02
psoriasis -2.100 4.3e-27

Gene RIF (200)

AA Sequence

MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSIL      1 - 70
RHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAE     71 - 140
KSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGL    141 - 210
VDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGA    211 - 280
GKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAK    281 - 350
ELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE    351 - 420
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG                                     421 - 457
//

Text Mined References (237)

PMID Year Title