Property Summary

NCBI Gene PubMed Count 55
PubMed Score 1491.51
PubTator Score 431.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.841 4.6e-07
chronic lymphosyte leukemia -1.300 3.8e-10
non-small cell lung cancer -1.317 5.4e-19
lung cancer -1.200 5.5e-04
interstitial cystitis 1.400 2.9e-03
lung adenocarcinoma -2.100 5.1e-15
mucosa-associated lymphoid tissue lympho... 1.864 2.6e-02

Protein-protein Interaction (9)

Gene RIF (29)

PMID Text
26660535 P serum level expression could be a reliable clinical biomarker to identify patients with underlying surface alternative pathway C5 convertase dysregulation.
24885016 In the pathogenesis of renal tubular damage, P can directly bind to PTECs and may accelerate AP activation by surpassing fH regulation
24355864 can directly interact with neutrophil myeloperoxidase resulting in activation of alternative pathway of complement
23677468 Our data show that physiological forms of human properdin bind directly to human platelets after activation by strong agonists in the absence of C3
22851705 Properdin released from human polymorphonuclear cells does not bind to zymosan or E. coli, but when incubated in properdin-depleted serum this form of properdin binds efficiently to both substrates in a strictly complement C3-dependent manner.
22815489 Factor h and properdin recognize different epitopes on renal tubular epithelial heparan sulfate.
22368277 Immune human serum that contained bactericidal Abs directed against the 2C7 lipooligosaccharide epitope required functional properdin to kill C4BP-binding strains, but not C4BP-nonbinding strains.
22338105 Properdin and SC5b-9 may be novel biomarkers for future risk of type 2 diabetes in this high-risk population and warrant further investigation.
22229731 report a large Finnish family with a novel mutation in the properdin gene. The mutation is located in exon 9 and changes guanine to adenine at nucleotide 1164 (c.1164G>A) that causes tryptophan to change to a premature stop codon (W388X).
21135110 tubular HS as a novel docking platform for alternative pathway activation via properdin, which might play a role in proteinuric renal damage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530262 The conventional mechanism of properdin function is to bind to and stabilize alternative pathway C3 convertases on the surface of Neisseria meningitidis and N. gonorrhoeae.
20382442 Human properdin can selectively recognize surfaces and enhance or promote alternative pathway of complement activation.
20337960 levels of properdin are not associated with childhood wheezing and atopy
20122735 CFP does not seem to confer any risk for age-related macular degeneration.
19934084 Properdin presence is associated with increased SC5b-9 excretion and worse renal function.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19584655 Factor P was expressed in 50% of choroidal neovascular membranes of patients with age-related macular degeneration(AMD). Additional studies need to investigate role of Factor P in development of AMD for potential therapeutic intervention.
19204726 Observational study of gene-disease association. (HuGE Navigator)
19005416 Significantly more transcripts encoding alternative pathway components factor B, C3 and properdin, and C3a receptor and C5a receptor were detected in grade 3 versus grade 0 or 1 biopsies of human cardiac allografts.
18791942 Properdin induces the formation of platelet-leukocyte aggregates via leukocyte activation, linking the complement system & platelet-leukocyte aggregates with potential significance in atherosclerotic vascular disease.
18753294 The contribution of properdin is pivotal in proteinuria-induced tubular complement activation and subsequent damage. Interference with properdin binding to tubular cells may provide an option for the treatment of proteinuric renal disease.
18579773 The human complement protein properdin binds to early apoptotic T cells and initiates complement activation, leading to C3b opsonization and ingestion by phagocytic cells.
18490764 study reports properdin binds predominantly to late apoptotic & necrotic cells but not to early apoptotic cells; binding occurs independently of C3b
16337490 A splice site mutation in exon 10 (c.1487-2A>G) was found in the properdin gene and co segregated with biochemically measured properdin deficiency.
8630395 A synthetic peptide covering positions 233-251 of the HIV-1 gp120 protein binds to complement proteins C3, C4, C5, C9, and properdin
7911492 A synthetic peptide covering positions 233-251 of the HIV-1 gp120 protein binds to complement proteins C3, C4, C5, C9, and properdin
7893437 A synthetic peptide covering positions 233-251 of the HIV-1 gp120 protein binds to complement proteins C3, C4, C5, C9, and properdin
7590866 A synthetic peptide covering positions 233-251 of the HIV-1 gp120 protein binds to complement proteins C3, C4, C5, C9, and properdin

AA Sequence

MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGG      1 - 70
LCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWS     71 - 140
GWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCH    141 - 210
GGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTME    211 - 280
QRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTC    281 - 350
RGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM    351 - 420
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL                         421 - 469
//

Text Mined References (58)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26660535 2016 Serum properdin consumption as a biomarker of C5 convertase dysregulation in C3 glomerulopathy.
24885016 2014 Properdin has an ascendancy over factor H regulation in complement-mediated renal tubular damage.
24355864 2014 Myeloperoxidase directs properdin-mediated complement activation.
23677468 2013 Identification of a novel mode of complement activation on stimulated platelets mediated by properdin and C3(H2O).
22851705 2012 The role of properdin in zymosan- and Escherichia coli-induced complement activation.
22815489 2012 Factor h and properdin recognize different epitopes on renal tubular epithelial heparan sulfate.
22368277 2012 Properdin is critical for antibody-dependent bactericidal activity against Neisseria gonorrhoeae that recruit C4b-binding protein.
22338105 2012 Elevated properdin and enhanced complement activation in first-degree relatives of South Asian subjects with type 2 diabetes.
22229731 2012 A novel mutation W388X underlying properdin deficiency in a Finnish family.
21135110 2011 Identification of tubular heparan sulfate as a docking platform for the alternative complement component properdin in proteinuric renal disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20530262 2010 An evaluation of the role of properdin in alternative pathway activation on Neisseria meningitidis and Neisseria gonorrhoeae.
20382442 2010 Native polymeric forms of properdin selectively bind to targets and promote activation of the alternative pathway of complement.
20337960 2010 Properdin in childhood and its association with wheezing and atopy.
20122735 2010 Screening of DNA-variants in the properdin gene (CFP) in age-related macular degeneration (AMD).
19934084 2010 Urinary properdin excretion is associated with intrarenal complement activation and poor renal function.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19584655 Complement Factor P in choroidal neovascular membranes of patients with age-related macular degeneration.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19005416 2008 Complement gene expression in human cardiac allograft biopsies as a correlate of histologic grade of injury.
18791942 2008 The complement factor properdin induces formation of platelet-leukocyte aggregates via leukocyte activation.
18753294 2008 Complement activation by tubular cells is mediated by properdin binding.
18579773 2008 The complement protein properdin binds apoptotic T cells and promotes complement activation and phagocytosis.
18490764 2008 Properdin binds to late apoptotic and necrotic cells independently of C3b and regulates alternative pathway complement activation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337490 2006 Association between combined properdin and mannose-binding lectin deficiency and infection with Neisseria meningitidis.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15491616 2004 The dimeric and trimeric solution structures of the multidomain complement protein properdin by X-ray scattering, analytical ultracentrifugation and constrained modelling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199963 2004 The lectin-complement pathway--its role in innate immunity and evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493642 2003 The endothelium as physiological source of properdin: role of wall shear stress.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12096136 2002 C-mannosylation and o-fucosylation of thrombospondin type 1 repeats.
11513971 2001 Expression and characterisation of the thrombospondin type I repeats of human properdin.
11090881 2000 Activation of the alternative pathway of human complement by autologous cells expressing transmembrane recombinant properdin.
10909851 2000 Molecular characterisation of 10 Dutch properdin type I deficient families: mutation analysis and X-inactivation studies.
10878002 2000 Properdin, the positive regulator of complement, is highly C-mannosylated.
10861231 2000 Interaction of C3b(2)--IgG complexes with complement proteins properdin, factor B and factor H: implications for amplification.
9710744 1998 Expression of properdin in complete and incomplete deficiency: normal in vitro synthesis by monocytes in two cases with properdin deficiency type II due to distinct mutations.
9127010 1997 Properdin, a positive regulator of complement activation, is released from secondary granules of stimulated peripheral blood neutrophils.
8871668 1996 Molecular characterization of properdin deficiency type III: dysfunction produced by a single point mutation in exon 9 of the structural gene causing a tyrosine to aspartic acid interchange.
8530058 1995 Sequence-based analysis of properdin deficiency: identification of point mutations in two phenotypic forms of an X-linked immunodeficiency.
7151327 1982 Properdin deficiency in a family with fulminant meningococcal infections.
6900901 1980 Current concepts in immunology: the alternative pathway of complement--a system for host resistance to microbial infection.
3421908 1988 Analysis of the interactions between properdin, the third component of complement (C3), and its physiological activation products.
3140783 1988 Analysis of the interaction between properdin and factor B, components of the alternative-pathway C3 convertase of complement.
2570030 1989 Localization of the properdin structural locus to Xp11.23-Xp21.1.
2009915 1991 Molecular cloning of the cDNA coding for properdin, a positive regulator of the alternative pathway of human complement.
1783405 1991 Genetic and physical mapping around the properdin P gene.
1431505 1992 Detection of properdin mRNA in human peripheral blood monocytes and spleen.
1417780 1992 Characterization of the human properdin gene.
162484 1979 Activation of the alternative complement pathway.