Property Summary

NCBI Gene PubMed Count 290
PubMed Score 837.30
PubTator Score 1983.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma -1.400 1.3e-04
cutaneous lupus erythematosus 1.400 4.1e-04
psoriasis -3.800 3.3e-06
osteosarcoma -4.133 2.4e-12
glioblastoma 1.300 4.2e-04
acute quadriplegic myopathy 1.540 8.8e-04
Amyotrophic Lateral Sclerosis 1.133 1.5e-05
adrenocortical carcinoma -1.204 4.0e-04
pancreatic ductal adenocarcinoma liver m... 1.429 4.2e-03
non-small cell lung cancer -2.299 1.0e-27
intraductal papillary-mucinous neoplasm ... 1.500 2.6e-03
colon cancer -1.400 1.8e-02
lung cancer -4.600 1.0e-05
interstitial cystitis 1.200 5.4e-04
lung adenocarcinoma -1.600 1.0e-14
group 3 medulloblastoma 1.300 2.0e-02
aldosterone-producing adenoma -1.264 6.1e-03
lung carcinoma -2.100 2.0e-26
spina bifida -1.675 4.4e-02
Pick disease 1.200 9.1e-05
Breast cancer -1.400 5.3e-11
Bipolar Disorder 1.115 4.6e-02
ulcerative colitis 1.400 7.2e-07
ovarian cancer -2.000 1.9e-07
Gaucher disease type 1 -1.100 1.6e-02
pituitary cancer -1.200 7.4e-03
dermatomyositis -1.400 3.3e-03

Synonym

Accession O15519 B4DJE0 B7Z9F9 O14673 O14674 O14675 O15137 O15138 O15356 O15510 O43618 O43619 O43620 O60458 O60459 Q53TS6 Q54AF1 Q96TE4 Q9UEW1
Symbols CASH
FLIP
MRIT
CLARP
FLAME
Casper
FLAME1
c-FLIP
FLAME-1
I-FLICE
c-FLIPL
c-FLIPR
c-FLIPS
CASP8AP1

Gene

PDB

3H11   2N5R   3H13  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (255)

PMID Text
26990987 procaspase-8:c-FLIPL exhibits localized enzymatic activity and is preferentially an activator, promoting DED-mediated procaspase-8 oligomer assembly, whereas procaspase-8:c-FLIPS lacks activity and potently blocks procaspase-8 activation
26865630 This conservation of IKK activation among the cFLIP family using different mechanisms suggests that the mechanism plays a critical role in their function.
26716649 High FLIP expression is associated with Pancreatic cancer.
26667821 A dual role for cFLIP in the maintenance of breast cancer stem cell viability, dependent upon its subcellular distribution.
26648023 Our findings suggested that GA induces apoptosis via the downregulation of cFLIPL and sensitized TRAIL-mediated apoptosis in Caki cells.
26529318 Identification and Characterization of the Interaction Site between cFLIPL and Calmodulin.
26261530 c-FLIP and RIP can inhibit caspase-8 activation and prompting HepG2 and Hep3B resistant to cell apoptosis induced by TRAIL.
26258756 Reduced miR-512 and the elevated expression of its targets cFLIP and MCL1 localize to neurons with hyperphosphorylated Tau protein in Alzheimer disease.
26195820 cFLIP-mediated and caspase-8-dependent limited cleavage of RIP1 is a new layer of mechanism that promotes NF-KB activation and lymphoma survival.
26142735 The result indicated that TMZ may overcome TRAIL resistance in GSCs by suppressing c-FLIP expression through c-Cbl-mediated ubiquitination and degradation
26053096 CDDO-Me rapidly reduced the protein levels of c-FLIPL and overexpression of c-FLIPL blocked CDDO-Me-induced cell death, but not vacuolation
26025363 A complete inhibition of PS1-induced apoptosis was achieved by knockdown of PS1-associated protein (PSAP), a mitochondrial proapoptotic protein that forms a complex with Bax upon induction of apoptosis, in the presence of gamma-secretase inhibitor.
25951185 Upregulation of hTERT+ in human lung epithelial cells and subsequent downregulation of FLIP by shFLIP-RNA annulled hTERT-mediated resistance to apoptosis.
25816367 Activation of AKR1C1/ERbeta induces apoptosis by downregulation of c-FLIP in prostate cancer cells.
25578476 Increased c-FLIP expression is associated with cutaneous T-cell lymphoma.
25230899 Over-expression of FLIP-L is associated with breast cancer.
25019384 The knockdown of c-FLIPL led to enhanced Th1 differentiation and elevated IL-4 production by Th2 cells, whereas the knockdown of c-FLIPS diminished GATA3 expression and IL-4 production.
25017325 Transfection of the c-FLIPp43 expression vector may induce the protein expression of NF-kappaBp65 and promote the activation of the NF-kappaB signaling pathway in the A375 melanoma cell line.
24946096 MS-275 represents a promising therapeutic approach in combination with TRAIL for treatment of cutaneous and uveal melanoma due to its ability to reduce c-FLIP expression.
24909691 Together, our results indicate that c-FLIP(L) promotes TRAIL resistance and inhibits caspase-3 and caspase-8 activation in HER2-positive breast cancer.
24816846 Data show that decreased type I interferon gene expression in T cell subsets of human CASP8 and FADD-like apoptosis regulating protein c-FLIPS transgenic female mice.
24711168 cytoplasmic c-FLIPL/s was an independent prognostic parameters for progression-free survival in locally advanced rectal cancer
24690311 These findings indicate that MUC16 protects EOC cells against TRAIL-induced apoptosis through multiple mechanisms including the blockade of TRAIL R2 expression and the regulation of cFLIP expression at both the transcriptional and the protein level.
24603337 H. pylori induces sensitivity to TRAIL apoptosis by regulation of FLIP and assembly of DISC, which initiates caspase activation, resulting in the breakdown of resistance to apoptosis.
24556678 Thioridazine enhances TRAIL-mediated apoptosis in renal tumors via the ROS-mediated inhibition of Akt signaling and the downregulation of c-FLIP(L) and Mcl-1 at the post-translational level.
24488010 we show that treatments that induce mitotic checkpoint activation and mitotic arrest downregulate FLICE-like inhibitory protein (FLIP) levels and sensitize several tumor cell lines to TRAIL-induced apoptosis
24438025 TRAIL promoted either mitogenesis or migration of HUVEC, evaluated using the wound healing method. Cleavage of caspase 8 was evaluated along with expression of the caspase 8-like molecule, cellular FLICE-inhibitory protein (long form) (c-FLIPL).
24398693 the C-terminal domain of c-FLIPL specifically inhibits the interaction of the caspase 8 prodomain with the RIP1 death domain and, thereby, regulates caspase 8-dependent NF-kappaB activation.
24355299 The four structure-based mutants (E80A, L84A, K169A and Y171A) of c-FLIP death effector domains disturb the interaction with FADD death effector domain, and that these mutations lower the stability of the c-FLIP death effector domain.
24005232 c-FLIP negativity identifies 9% of patients with a highly aggressive disease course (P = 0.0001) and thus is a valuable prognostic biomarker in pancreatic cancer.
23853530 The knockout of c-FLIP and Hsp27 genes together enhances apoptosis even under 1 mu M, rather than low concentration, of doxazosin in PC-3 cells.
23696271 cFLIP upregulated the expression of viral restriction factors.
23696271 cFLIP-induced upregulation of TRIM-5alpha expression inhibits HIV-1 CA expression
23615398 CHOP-mediated DR5 upregulation and proteasome-mediated downregulation of c-FLIP.
23519470 novel ROS-dependent post-translational modifications of the c-FLIP protein that regulate its stability, thus impacting sensitivity of cancer cells to TRAIL.
23518915 An increased expression of c-FLIP may be an important factor in the progression of cervical cancer
23483900 A novel mechanism of HBx-induced NF-kappaB activation in which ternary complex formation is involved among HBx, p22-FLIP and NEMO, is reported.
23371318 ERK controls epithelial cell death receptor signalling and c-FLIP in ulcerative colitis
23322903 Studies indicate that the anti-apoptotic protein c-FLIP is an important regulator of death receptor signaling, including TNFR1, Fas, DR4, and DR5.
23319802 findings provide the first evidence showing that mTORC2 stabilizes FLIP(S), hence connecting mTORC2 signaling to the regulation of death receptor-mediated apoptosis
23255321 c-FLIP may play an important role in the metastatic potential of osteosarcoma to the lung
23247197 SIRT1 inhibition increases Ku70 acetylation, and the acetylated Ku70 with a decreased function mediates the induction of DR5 and the down-regulation of c-FLIP by up-regulating c-Myc/ATF4/CHOP pathway,promotes the TRAIL-induced apoptosis
23235765 Data show that alterations of the apoptosis-related protein FLIP is common in granulosa cell tumor (GCT), and suggest that expression of FLIP might play role in the pathogenesis of GCT, possibly by inhibiting apoptosis.
23230268 Apoptosis-related genes such as the caspase-8, FLIP, and DR5 genes specifically interfere with interferon-induced apoptosis.
23167276 Adult acute myeloid leukemia patients with higher-than-median mRNA expression of the long splice form(but not the short splice form) had significantly lower 3 year overall survival than those with low expression.
23028678 the "biomarker signature" of FLIP/Sp1/Sp3 combined with Gleason score predicted disease recurrence
22948392 Suppression of HSP70 expression sensitizes NSCLC cell lines to TRAIL-induced apoptosis by upregulating DR4 and DR5 and downregulating c-FLIP-L expressions
22842544 TRAIL-induced apoptosis in human renal cancer cells by upregulation of DR5 as well as downregulation of c-FLIP and Bcl-2.
22781394 review of the structural and functional biology of c-FLIP with direct relevance to carcinogenesis [review]
22753273 CHOP represses cFLIPL expression in Caki cells.
22683265 analysis of stoichiometry of the CD95 death-inducing signaling complex and demonstration of how procaspase-8, procaspase-10, and c-FLIP form DED chains at the DISC, enabling the formation of dimers and efficient activation of caspase-8
22504646 Survival of activated and also of immature dendritic cells is regulated by BAK and shows that tumor necrosis factor (TNF) is protective only in the presence of FLIPL.
22393362 BCL-X(L) and BCL-2 but not FLIP(L) acts in synergy with MYC to drive AML development
22345097 API-1 reduces c-FLIP and enhances TRAIL-induced apoptosis independent of its Akt-inhibitory activity
22288650 data suggest that Ro52/SSA is involved in death receptor-mediated apoptosis by regulating c-FLIP(L)
22219201 an important role for TRAF7 in the activation of JNK following TNFalpha stimulation and involvement of this protein in regulating the turnover of c-FLIP
22190004 It was diminished expression of the c-FLIP(L) isoform in urothelial carcinoma tissues as well as in established carcinoma cell lines compared with normal urothelial tissues and cells, whereas c-FLIP(S) was unchanged.
22126763 Kashin-Beck disease patients have significant increased FADD expression in the middle layer but decreased FLIP expression in the upper layer of the cartilage.
22072062 Endoplasmic reticulum stress sensitizes cells to TRAIL through down-regulation of FLIP and Mcl-1 and PERK-dependent up-regulation of TRAIL-R2.
22027693 This study identifies SART1 as a previously unidentified regulator of c-FLIP and drug-induced activation of caspase-8.
21912376 results demonstrate that the H204 residue is responsible for c-FLIP(L) binding to CaM, which mediates the anti-apoptotic function of c-FLIP(L)
21868755 a novel mechanism through which the regulatory effects of c-FLIP on death receptor signaling in neoplastic cells are controlled by glycogen synthase kinase-3
21856935 our study reveals a novel link between NF-kappaB and PI3K/Akt and establishes c-FLIP as an important regulator of FasL-mediated cell death.
21803845 PMLRARalpha binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21691254 Data suggest that persistent Flice inhibitory protein-S expression is involved in the longevity of neonatal polymorphonuclear leukocytes.
21638304 cFLIP expression showed no significant correlation to DLBCL subtypes (GCB or non-GCB) but was associated with a worse clinical outcome.
21562857 increased expression of cFLIP protects cells from both interferon-alpha and death receptor mediated apoptosis
21525012 Epidermal growth factor receptor-mediated tissue transglutaminase overexpression couples acquired tumor necrosis factor-related apoptosis-inducing ligand resistance and migration through c-FLIP and MMP-9 proteins in lung cancer cells
21483669 cFLIP-induced upregulation of TRIM-5alpha expression inhibits HIV-1 CA expression
21480219 BAY 11-7085 rapidly inhibited c-FLIP(L) expression in colon and pancreatic cancer cell lines during adhesion to mesothelial cells.
21454681 Cellular FLICE-inhibitory protein (cFLIP) isoforms block CD95- and TRAIL death receptor-induced gene induction irrespective of processing of caspase-8 or cFLIP in the death-inducing signaling complex
21435442 KSR1 is overexpressed in endometrial carcinoma and regulates proliferation and TRAIL-induced apoptosis by modulating FLIP levels
21403465 Silencing FLIP(L) modifies TNF-induced apoptotic protein expression.
21394196 cFLIP-induced upregulation of TRIM-5alpha expression inhibits HIV-1 CA expression
21324892 Modeling reveals that dynamic regulation of c-FLIP levels determines cell-to-cell distribution of CD95-mediated apoptosis.
21307400 Reveal unique regulatory networks in acute myeloid leukemia whereby FLIP regulation of HO-1 provides cells with secondary anti-apoptotic protection against TNF induced death signals in these highly death-resistant cells.
21153369 regulation of cell death by c-FLIP phosphorylation
21107885 Itch/AIP4-independent proteasomal degradation of cFLIP induced by the histone deacetylase inhibitor SAHA sensitizes breast tumour cells to TRAIL-induced apoptosis.
21071136 review of molecular mechanisms that control c-FLIP expression and current research into inhibitors of the protein [review]
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20975036 These studies indicate that cFLIP protein is a crucial component of the signaling pathway involved in cardiac remodeling and heart failure.
20882347 Triggering of death receptor apoptotic signaling by human papillomavirus 16 E2 protein in cervical cancer cell lines is mediated by interaction with c-FLIP.
20876774 Both the long and the short isoform of the antiapoptotic protein c-FLIP are critical regulators of death receptor-induced apoptosis in pancreatic carcinoma cells and are suppressed by chemotherapeutics.
20812013 CD30/CD95 crosstalk experiments revealed that CD30 ligation leads to NFkappaB-mediated cFLIP upregulation in cALCL cells, which in turn enhanced resistance to CD95-mediated apoptosis.
20802294 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20696707 The function of c-FLIP(L) as a pro- or antiapoptotic protein in DR-mediated apoptosis is important for understanding the regulation of CD95-induced apoptosis, where subtle differences in c-FLIP concentrations determine life or death of the cells.
20689807 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595005 PDCD4 plays an important role in mediating the sensitivity of gastric cancer cells to TRAIL-induced apoptosis through FLIP suppression.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20561424 mRNA expressions of DLK1, c-FLIPL and c-FLIPS are abnormal in bone marrow mononuclear cells of myelodysplastic syndrome patients.
20508645 The anti-apoptotic functions of c-FLIPL are mediated by its effects on Gsk3beta activity, and p27 and caspase-3 levels.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20449949 Data suggest that FLIP potentially extends the lifespan of synovial cells and thus contributes to the progression of joint destruction in juvenile idiopathic arthritis.
20372864 Disclose a novel regulatory mechanism inHepG2 cells where down-regulation of c-FLIP by miR-512-3p contributed to taxol-induced apoptosis.
20335528 Although deletion of cFLIP does not alter the primary development of B cells, adoptively transferred cFLIP-deficient follicular B cells do not effectively participate in the germinal center response.
20227749 Data demonstrate that c-FLIP(L) exhibits multiple functions in ovarian cancer: first by concomitantly evading the natural immunity mediated by TRAIL-induced cell death, and second by augmenting cell motility and invasion in vivo.
20224598 FLIP expression is transcriptionally regulated by hnRNP K and nucleolin, and may be a potential prognostic and therapeutic marker for nasopharyngeal carcinoma.
20218968 The role of c-FLIP is critical in the protection of erythroid-differentiated cells from apoptosis or in the determination of their sensitivity to TNF-mediated programmed cell death.
20087343 Egr-1 drives c-FLIP expression and the short splice variant of c-FLIP (c-FLIP(S)) specifically inhibits DR5 activation.
20016063 role for nuclear cFLIP-L in the modulation of Wnt signaling
19956887 eupatolide could augment TRAIL-induced apoptosis in human breast cancer cells by down-regulating c-FLIP expression through the inhibition of AKT phosphorylation
19949310 CDODO-Me-12 and CDODO-Me-11 downregulated the levels of anti-apoptosis protein c-FLIP in HL-60, U937 and K562 leukemic cell lines.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19906927 our results demonstrate that apoptosis of HSV-1-infected iDCs requires both c-FLIP downregulation and diminished expression of viral LAT.
19896469 These results indicate that AMPK activators facilitate the activation by TRAIL of an apoptotic cell death program through a mechanism independent of AMPK and dependent on the down-regulation of cFLIP levels.
19890350 Knockdown of c-FLIP by a enhanced basic apoptosis rates in cutaneous lymphoma cells and diminished the CD30-mediated suppression of apoptosis, thus proving the significance of c-FLIP in this context
19816511 Results identify c-FLIP(L) as a susceptibility factor under the influence of epistatic modifiers for the development of autoimmunity.
19802016 Results suggest that Akt confers resistance, in part, by modulating CDDP-induced, p53-dependent FLIP ubiquitination.
19798106 Data suggest that c-FLIP downregulation represents a mechanism by which diverse anticancer regimens can facilitate tumor cell execution by CD95/Fas through the direct pathway of caspase activation.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19734124 CD133-high cells may be resistant to TRAIL due to high expression of FLIP.
19728335 IKKalpha, IKKbeta, RANK, Maspin, c-FLIP, Cip2 and cyclinD1 were found to show significant differences between hepatocellular tumor tissue and its corresponding adjacent tissue.
19710364 The interaction between Mib1 and cFLIP decreases the association of caspase-8 with cFLIP, which activates caspase-8 and induces cell death.
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19543235 FADD-Like Apoptosis Regulating Protein silencing sensitized non-small-cell lung cancer cells but not normal cells to chemotherapy in vitro, and silencing FLIP in vivo retarded non-small-cell lung cancer cells xenograft.
19476635 Increased c-FLIP is associated with cervical intraepithelial neoplasia and cervical carcinoma.
19439735 production of either c-FLIP(S) or c-FLIP(R) in humans is defined by a single nucleotide polymorphism in a 3' splice site of the c-FLIP gene (rs10190751A/G); increased lymphoma risk associated with the rs10190751 A genotype causing c-FLIP(R) expression.
19433309 These findings describe a novel function of c-FLIP-L involved in AP-1 activation and cell proliferation.
19409438 In summary, the short isoform of c-FLIP is a key regulator in TRAIL-Embelin-mediated apoptosis in malignant glioma.
19398149 the short isoform of c-FLIP and bcl-2 are key regulators in TRAIL-Myricetin mediated cell death in malignant glioma.
19372246 c-FLIP expression is induced in the abnormal alveolar epithelium of patients with idiopathic pulmonary fibrosis/usual interstitial pneumonia
19363595 gp120 plays an important role, via involvement of c-FLIPL, in T-cell apoptotic cell death due to HIV-1 infection.
19363595 cFLIP-induced upregulation of TRIM-5alpha expression inhibits HIV-1 CA expression
19343040 S193 phosphorylation is mediated by PKC-aplha and PKC-beta and reveal a connection between c-FLIP phosphorylation and ubiquitylation, as S193 mutations differently affect c-FLIP ubiquitylation.
19339247 TNFalpha facilitates the reduction of FLIP(L) protein, which is dependent on the phosphatidylinositol 3-kinase/Akt signaling.
19321593 Overexpression of c-FLIPL is associated with ovarian cancer.
19282655 Over-expression of c-FLIP confers the resistance to TRAIL-induced apoptosis on gallbladder carcinoma.
19249545 Pig islets expressing human c-FLIP(L) are significantly resistant to human cytotoxic lymphocyte killing and exhibit beneficial effects to prolong xenograft survival.
19243385 inhibition of c-FLIP(L) expression might be a potential strategy for lung cancer therapy, especially for those lung cancers resistant to the agonistic antibody against death receptors
19223508 Increase in FLIP is associated with prostate tumors.
19203346 the loss of Bcr-Abl in imatinib-resistant K562 cells led to the down-regulation of c-FLIP and subsequent increase of TRAIL sensitivity
19177145 modulation of the CD95 signaling pathway by cFLIP in basal keratinocytes may explain the spatial localization of spongiosis in suprabasal epidermal layers, and provides new insights into the pathogenesis of spongiosis formation in eczematous dermatitis
19161534 FLIP expression was strong in most (103/107; 96.3%) of the prostate cancers, and only four cancers (3.7%) showed decreased immunoreactivities compared with the normal cells.
19115040 These data suggest caspase 8, but not cFLIP, activation induced by C5a leads to cell death if protein synthesis of antiapoptotic protein(s) is blocked.
19109151 While dispensable for the development of bone marrow precursor B cells, cFLIP is necessary for B cell maturation in the periphery.
19090833 Ubiquitination of cFLIP(L) inhibits the interaction between cFLIP(L) and Itch in T. cruzi-infected cells.
18976975 Knockdown of CASP8 and FADD-like apoptosis regulator (CFLAR) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18840411 an apoptotic inhibitory complex comprised of DR5, FADD, caspase-8, and c-FLIP(L) exists in MCF-7 cells, and the absence of c-FLIP(L) from this complex induces DR5- and FADD-mediated caspase-8 activation in the death inducing signaling complex
18838202 Overexpression of FLIP reduced TRAIL and TNF-alpha-induced apoptosis in ML-1 cells. However, while FLIPL completely abrogated apoptosis, FLIPS allowed for BID cleavage and caspase-3 activation.
18823309 Observational study of gene-disease association. (HuGE Navigator)
18820704 These results suggest that simultaneously targeting both FLIP and XIAP may prove useful in the treatment of cancers, particularly those in which the intrinsic mitochondrial apoptotic pathway has been compromised.
18767116 anti-apoptotic functions of cFLIPs may be attributed to inhibit oxaliplatin-induced apoptosis through the sustained XIAP protein level and Akt activation.
18726983 Androgenic protection from TRAIL-induced apoptosis is via enhanced transcription of FLIP in prostate cancer cells. Loss of androgen-sensitivity in androgen-depletion-independent prostate cancer cells. Potential target for therapy of prostate cancer.
18603835 cFLIP is an essential pro-survival factor for granulosa cells, and it prevents granulosa cell apoptosis by inhibiting procaspase-8 activation.
18593367 reversion of Fas resistance is mediated through CD40/CD40L ligation rather than IFN-gamma stimulation by inhibiting synthesis of c-FLIP
18509086 preventing autocrine CD95L signaling by c-FLIP facilitates T-cell effector function and an efficient immune response
18414015 c-FLIPL promotes the motility of HeLa cells by activating FAK and ERK, and increasing MMP-9 expression.
18398344 c-Flip (CASP8 and FADD-like apoptosis regulator) is a key regulator of the cardiac response to ventricular pressure overload.
18391984 FOXO3a mediates the androgen-dependent regulation of FLIP and contributes to TRAIL-induced apoptosis of LNCaP cells.
18339897 TTP plasma-mediated apoptosis appears to involve IFNG-induced acceleration of c-FLIP degradation, sensitizing cells to TRAIL-mediated caspase-8 activation and cell death.
18314443 cFLIP was overexpressed in CD4+/CD26- tumor cells with normal or enhanced Fas expression
18264131 Since Gli2 silencing not only downregulates cFlip, but also Bcl-2, Gli2 could be a key target for a novel therapeutic approach in basal cell carcinoma.
18257744 interaction of calmodulin cellular FLICE-like inhibitory protein
18243739 Study indicated that c-FLIP(L) might be a suppressor of Fas-mediated apoptosis in Fas antigen expressing colon carcinoma cells.
18189268 Sanguinarine-mediated apoptosis is blocked by ectopic expression of Bcl-2 and cFLIPs
18084329 cFLIP represents an attractive therapeutic target for melanoma treatment, especially in combination with TRAIL receptor agonists.
18073330 (c-FLIP), which is dependent on the NF-kappaB pathway in normal muscle cells, is down-regulated in limb-girdle muscular dystrophy type 2A biopsies.
17988665 IFN-alpha causes a transient upregulation of c-FLIP expression, at least through PKCalpha-mediated activation of NF-kappaB
17982483 CK2 regulates endometrial carcinoma cell sensitivity to TRAIL and Fas by regulating FLIP levels.
17932249 reconstitution of ATM kinase activity decreases FLIP protein levels and restores Fas sensitivity in Hodgkin lymphoma-derived cells
17922291 Overexpression of cFLIP(L) is a frequent event in head and neck squamous cell carcinoma
17912957 Human keratinocytes were transfected with either Flip, Faim, or Lifeguard (LFG). Our results suggest that heterotopic expression of antiapoptotic proteins can induce the resistance of keratinocytes to a major mechanism of rejection.
17762208 The mechanism by which antioxidant status alters FLIP levels following neonatal HI may be related to the ability to detoxify H2O2 produced following neonatal HI.
17726263 Caspase-8 and cFLIP are upregulated during colorectal carcinogenesis.
17697742 VPA significantly increased sensitivity of leukemic cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and led to downregulation of c-FLIP (L) expression.
17659339 bortezomib and TRAIL combination caused further down-regulation of cFLIP protein and increased apoptosis in CHL cells
17646662 enhanced proliferative nature of human leukemia cells is caused by elevated NF-kappaB and FLIP responses
17638906 RIP and c-FLIP-mediated assembly of the death-inducing signaling complex in nonrafts is a critical upstream event in TRAIL resistance
17581950 FLIP(L) is essential for tumor necrosis factor (TNF)/tumor necrosis factor receptor I (TNFRI)-mediated neuroprotection after glucose deprivation in transgenic mice.
17573774 cFLIP-L is prone to aggregate and impairs ubiquitin-proteasome system function, which could be involved in the pathological function of cFLIP-L expressed in certain cancer cells
17559541 The expression of Fas, FasL and c-FLIP in colorectal carcinoma implicates c-FLIP as an inhibitor of the Fas-FasL-induced death pathway in these tumors. Moreover, c-FLIP conveys independent prognostic information in the presence of classic prognosticators.
17513603 c-FLIP plays a pivotal role in modulating drug-induced apoptosis in breast cancer cells
17450141 Observational study of gene-disease association. (HuGE Navigator)
17441421 There was a negative relationship between the expression of FLIP and PTEN in laryngeal squamous cell carcinoma.
17440816 Downregulation of either FLIP or XIAP but not Bcl-2 restored sensitivity of Colo320 cells to Apo2L/TRAIL.
17376892 induction of the short c-FLIP isoforms inhibits the onset of CD95-induced apoptosis in primary CD40-stimulated ALL cells despite high CD95 expression.
17272514 Enforced long-form cFLIP (cFLIP(L)) expression reduced release of cathepsin B from lysosomes and attenuated apoptosis.
17106251 Doxorubicin-mediated downregulation of cFLIPS at the post-transcriptional level is sufficient to enhance TRAIL sensitivity in PC3 prostate carcinoma cells.
17070520 Treatment with sodium arsenite resulted in upregulation of the endogenous TRAIL and downregulation of the cFLIP gene expression followed by cFLIP protein degradation and, finally, by acceleration of TRAIL-induced apoptosis
17056549 These data demonstrate specific activation of c-FLIP by HCMV IE2 and indicate a novel role for c-FLIP in the pathogenesis of HCMV retinitis.
17003335 The Fas antagonistic antibody ZB4 and small interfering RNA to FLIP prevented low IL-1beta-stimulated beta-cell proliferation.
16901543 Anti-apoptotic signaling of CD40 involves induction of c-FLIP proteins.
16740746 The NFkappaB-mediated overexpression of cFLIP(long)represent alternative mechanisms for deregulating the extrinsic apoptotic pathway in LBCL subtypes defined by gene expression profiling.
16720717 Results suggest that, in addition to its proapoptotic function, par-4 acts as a novel transcription cofactor for androgen receptors to target c-FLIP gene expression.
16611896 results suggested that the TNF-alpha-induced apoptotic pathway is inhibited by a sustained c-FLIP expression associated with the expression of HCV core protein, which may play a role in HCV-mediated pathogenesis
16472594 Inhibition of Flip by antisense oligonucleotide reverted the resistance of CD LPLs to FAS-induced apoptosis.
16441226 Review focuses on the role of c-FLIP as a tumour progression factor, with particular emphasis on contribution of c-FLIP to pathogenesis of Hodgkin's lymphoma.
16436054 Taken together, Tax inhibits Fas-mediated apoptosis by up-regulating c-FLIP expression in HTLV-I-infected cells, and NF-kappaB activity plays an essential role in the up-regulation of c-FLIP.
16403915 c-FLIP confers Tax-mediated resistance toward CD95-mediated apoptosis.
16304056 overexpression of c-FLIP protects ALK+ ALCL cells from FAS-induced apoptosis and may contribute to ALCL pathogenesis.
16298825 Expression of FLIP molecules may be, at least in part, an early prognostic indicator in the treatment of elderly acute myeloid leukemia patients.
16247474 c-FLIP inhibits apoptosis in response to chemotherapy in colorectal cancer cells
16211288 the PI 3-K/Akt signaling pathway may, in part, regulate Fas-mediated apoptosis in HL-60 cells through c-FLIP expression
16077198 Cycloheximide sensitizes colorectal tumor cells to TNF-alpha induced apoptosis by reducing FLIP levels.
16052516 results demonstrate a critical role for PKCdelta/NF-kappaB in the regulation of FLIP in human colon cancer cells
16052233 findings show that E2F1 triggers apoptosis in lung adenocarcinoma cell lines by a mechanism involving the specific downregulation of the cellular FLICE-inhibitory protein short, leading to caspase-8 activation at the death-inducing signaling complex
16014121 c-FLIP might contribute to the carcinogenesis and aggressiveness of endometrial carcinoma and might be a useful prognostic factor in the tumor
15956881 The majority of Langerhans cell histiocytosis cells express this protein.
15917295 c-FLIP knock-down with a small interfering RNA significantly restores Fas-mediated apoptosis in infected cells
15899875 FLIP protected mouse lung endothelial cells against hypoxia/reoxygenation by blocking both caspase 8/Bid and Bax/mitochondrial apoptotic pathways.
15886205 The conformation-based predisposition of c-FLIP(S) to ubiquitin-mediated degradation introduces a novel concept to the regulation of the death-inducing signaling complex
15864316 Our results suggest for the first time a critical role for FLIP in the regulation of apoptosis triggered by TRAIL in endometrial carcinoma cells.
15843523 A mechanism by which c-FLIP(long form)(CFLAR) influences effector T cell function in CFLAR transgenic mice is via its activation of caspase-8, which in turn cleaves CFLAR to allow receptor interacting protein (RIP)1 recruitment and NF-kappa B activation.
15832422 c-FLIP is specially overexpressed in colon cancers and it might contribute to carcinogenesis of normal colonic mucosa.
15815586 differential spatial and temporal regulation of cFLIP-alpha and cFLIP-delta expression that may influence the magnitude of cell death
15761846 Established and analyzed a transgenic mouse model that overexpresses human c-FLIPS (CFLAR) in thymocytes and peripheral T cells. Data suggests a specific in vivo function for c-FLIPS in the maintenance of restimulated T cells.
15760909 c-FLIP(L) functions primarily as an inhibitor of death receptor-mediated apoptosis through TRAIL and caspase-8 activation
15731171 c-FLIP promoter was shown to contain multiple functional androgen response elements.
15722350 cFLIP/CFLAR is an essential NF-kappa B-dependent antiapoptotic gene in the tumor necrosis factor alpha-regulated pathway in epidermal keratinocytes
15701651 CLARP inhibits caspase-8 induced, ASC-mediated NF-kappaB activation and IL-8 production
15701649 c-FLIPR, an isoform of c-FLIP, is a new regulator of death receptor-induced apoptosis.
15686714 Heart graft rejection biopsies have elevated FLIP mRNA expression levels.
15653751 T cell blasts surviving activation-induced cell deathare memory CD44high cells with increased c-FLIP expression.
15644494 DDB2 regulates TNF signaling-mediated apoptosis via cFLIP and contributes to acquired cross-resistance.
15557152 Constitutive overexpression of c-FLIP (long form) in T cells is sufficient to drive Th2 polarization of effector T cell responses and indicates that it might function as a key regulator of T helper (Th) cell differentiation.
15540114 Results indicate that some tumor cells are resistant to death receptor-mediated apoptosis by expressing cellular FLIP, and that histone deacetylase inhibitors sensitize such resistant tumor cells by directly downregulating cellular FLIP mRNA.
15485835 c-FLIPL is recruited to death receptor 5 independent of Fas-associated protein with death domain (FADD)
15459191 cFLIP(L) is not only a central antiapoptotic modulator of TRAIL-mediated apoptosis but also an inhibitor of TRAIL-induced NF-kappaB activation and subsequent proinflammatory target gene expression
15354734 strong c-FLIP expression in nodular lymphocyte-predominant Hodgkin lymphoma was associated with transformation to diffuse large B-cell lymphoma; the majority of DLBCL cases tested were strongly c-FLIP-positive.
15334061 Malignant mesothelioma cells develop an intrinsic resistance to apoptosis induced by death receptors upregulating the expression of the antiapoptotic protein c-FLIP.
15304499 When fusesd with Tat protein, prevesnts adverse apoptosis nd prolongs survival in tumor cells.
15297424 the inhibitory protein c-FLIP(L) is involved in resistance to CD95-mediated apoptosis in ovarian carcinoma cells with wild-type p53
15273717 Regulation by AMP-activated protein kinase-related kinase 5
15258564 FLIP plays a significant role in the regulation of apoptosis in human ovarian cancer cells and their sensitivity to cisplatin.
15183989 The frequent expression and coexpression of Fas, FasL, and c-FLIP in urothelial carcinomas implicates c-FLIP as an inhibitor of the Fas-FasL-induced death pathway in these tumors.
15096587 down-regulation of cellular FLICE-inhibitory protein through the use of specific small inhibitory RNAs leads to reduced viability of the L428 and L591 HL-derived cell lines
15078899 the selective down-regulation of c-FLIP by small interfering RNA oligoribonucleotides was sufficient to sensitize Hodgkin/Reed-Sternberg cells to CD95 and tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis
15024054 Results demonstrate that FLIP(p43) processed by caspase 8 specifically interacts with TRAF2 and subsequently induces activation of the NF-kappaB signaling pathway.
14662022 Akt activity promotes human gastric cancer cell survival against TRAIL-induced apoptosis via upregulation of FLIP(S), and that the cytotoxic effect of TRAIL can be enhanced by modulating the Akt/FLIP(S) pathway in human gastric cancers.
14637155 In this study, we show that c-FLIP(L) but not c-FLIP(S) physically binds to Daxx through interaction between C-terminal domain of c-FLIP(L) and Fas-binding domain of Daxx, an alternative Fas signaling adaptor.
14578361 In T cells, c-FLIP expression led to inhibition of IL-2 production, in contrast to the readily detectable c-FLIP-induced activation in Jurkat cells.
14562111 FLIP(L) and FLIP(S) are differentially regulated, and that the relative levels of both isoforms play a role in the regulation of apoptosis in myelodysplastic syndrome
12820373 cFLIP is an important determinant of susceptibility to death receptor-induced apoptosis in bladder carcinomas.
12746452 cFLIP-L exerts its anti-apoptotic activity, in part, by inhibiting p38 MAPK activation, an additional anti-apoptotic effect for this protein.
12716387 Expression is increased in stomach cancer
12592338 Constitutively active Akt1 protects HL60 leukemia cells from TRAIL-induced apoptosis through a mechanism involving NF-kappaB activation and up-regulation of this protein
12574377 Constitutive expression of the long form of human FLIP leads to an enhanced and prolonged inflammatory response in the central nervous system during experimental allergic encephalitis in DBA mice.
12556488 Our results show that c-FLIP(L) and c-FLIP(S) potently control TRAIL responses, both by distinct regulatory features, and further imply that the differentiation state of malignant cells determines their sensitivity to death receptor signals.
12552004 Adenovirus E1A inhibited TNF-alpha-dependent induction of c-FLIP(S) mRNA and stimulated ubiquitination- and proteasome-dependent degradation of c-FLIP(S) protein in Hela cells
12496482 The metabolism of FLIP is essential to the death of prostatic cells in culture.
12496481 In response to doxorubicin, the level of FLIP decreased in all prostatic cell lines tested and correlated with the onset and magnitude of CASP8 and PARP cleavage in PC3 cells.
12496285 c-FLIP expression is regulated by calcium/calmodulin-dependent protein kinase II and modulates Fas-mediated signaling in glioma cells
12477972 The consequences of FasL overexpression depend on the subcellular compartment and species in which FasL enforced expression is targeted and this is at least partially related to FLIP levels
12432255 c-FLIP may play a critical role in regulating Fas-mediated apoptosis in prostate cancer cells
12407100 These results provide new insights into the mechanisms of bile acid cytotoxicity and the proapoptotic effects of cFLIP phosphorylation in TRAIL signaling.
12393527 results demonstrate a definite role for FLIP in the stem cell factor-induced protection of erythroid colony forming cells from IFNgamma-initiated apoptosis
12115181 FLICE-inhibitory protein expression in synovial fibroblasts and at sites of cartilage and bone erosion in rheumatoid arthritis.
12060768 switches Fas-mediated glucose signaling in human pancreatic beta cells from apoptosis to cell replication switches Fas-mediated glucose signaling in human pancreatic beta cells from apoptosis to cell
12031968 cFLIP may have an impact on the outcome of death receptor-triggered responses by directing the intracellular signals from beta-cell death to beta-cell survival
11940602 An inducible pathway for degradation of FLIP protein sensitizes tumor cells to TRAIL-induced apoptosis
11877293 Higher levels of expression of FLIP were present in TRAIL-resistant multiple myeloma cells, and sensitivity to TRAIL was restored by lowered FLIP protein levels.
11830587 The human herpes virus 8-encoded viral FLICE inhibitory protein physically associates with and persistently activates the Ikappa B kinase complex.

AA Sequence

MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKR      1 - 70
ILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEK     71 - 140
LNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKE    141 - 210
QRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQK    211 - 280
FLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAG    281 - 350
KPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP    351 - 420
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT              421 - 480
//

Text Mined References (293)

PMID Year Title
26990987 2016 Co-operative and Hierarchical Binding of c-FLIP and Caspase-8: A Unified Model Defines How c-FLIP Isoforms Differentially Control Cell Fate.
26865630 2016 Distinct Activation Mechanisms of NF-?B Regulator Inhibitor of NF-?B Kinase (IKK) by Isoforms of the Cell Death Regulator Cellular FLICE-like Inhibitory Protein (cFLIP).
26716649 2016 Simultaneous gene silencing of KRAS and anti-apoptotic genes as a multitarget therapy.
26667821 2015 Cytoplasmic levels of cFLIP determine a broad susceptibility of breast cancer stem/progenitor-like cells to TRAIL.
26648023 2016 Gambogic acid induces apoptosis and sensitizes TRAIL-mediated apoptosis through downregulation of cFLIPL in renal carcinoma Caki cells.
26529318 2015 Identification and Characterization of the Interaction Site between cFLIPL and Calmodulin.
26261530 2015 Protective effect of RIP and c-FLIP in preventing liver cancer cell apoptosis induced by TRAIL.
26258756 2015 Reduced miR-512 and the Elevated Expression of Its Targets cFLIP and MCL1 Localize to Neurons With Hyperphosphorylated Tau Protein in Alzheimer Disease.
26195820 2015 RIP1 Cleavage in the Kinase Domain Regulates TRAIL-Induced NF-?B Activation and Lymphoma Survival.
26142735 2015 Temozolomide sensitizes stem-like cells of glioma spheres to TRAIL-induced apoptosis via upregulation of casitas B-lineage lymphoma (c-Cbl) protein.
26053096 2015 Ca2+ influx-mediated dilation of the endoplasmic reticulum and c-FLIPL downregulation trigger CDDO-Me-induced apoptosis in breast cancer cells.
26025363 2015 Cellular FLICE-like Inhibitory Protein (c-FLIP) and PS1-associated Protein (PSAP) Mediate Presenilin 1-induced ?-Secretase-dependent and -independent Apoptosis, Respectively.
25951185 2015 Overexpression of Telomerase Protects Human and Murine Lung Epithelial Cells from Fas- and Bleomycin-Induced Apoptosis via FLIP Upregulation.
25816367 2015 Activation of AKR1C1/ER? induces apoptosis by downregulation of c-FLIP in prostate cancer cells: A prospective therapeutic opportunity.
25578476 2015 BIN1 tumor suppressor regulates Fas/Fas ligand-mediated apoptosis through c-FLIP in cutaneous T-cell lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25230899 2015 The TRAIL system is over-expressed in breast cancer and FLIP a marker of good prognosis.
25019384 2014 The regulation and role of c-FLIP in human Th cell differentiation.
25017325 2014 c-FLIPp43 induces activation of the nuclear factor??B signaling pathway in a dose-dependent manner in the A375 melanoma cell line.
24946096 2014 Class I-specific histone deacetylase inhibitor MS-275 overrides TRAIL-resistance in melanoma cells by downregulating c-FLIP.
24909691 2014 C-FLIP(L) contributes to TRAIL resistance in HER2-positive breast cancer.
24816846 2014 c-FLIP-Short reduces type I interferon production and increases viremia with coxsackievirus B3.
24711168 2014 Prognostic value of c-FLIPL/s, HIF-1?, and NF-?? in stage II and III rectal cancer.
24690311 2014 MUC16 mucin (CA125) attenuates TRAIL-induced apoptosis by decreasing TRAIL receptor R2 expression and increasing c-FLIP expression.
24603337 2014 Helicobacter pylori sensitizes TNF-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis in human gastric epithelial cells through regulation of FLIP.
24556678 2014 Antipsychotic agent thioridazine sensitizes renal carcinoma Caki cells to TRAIL-induced apoptosis through reactive oxygen species-mediated inhibition of Akt signaling and downregulation of Mcl-1 and c-FLIP(L).
24488010 2015 Delaying mitotic exit downregulates FLIP expression and strongly sensitizes tumor cells to TRAIL.
24438025 2014 Involvement of caspase 8 and c-FLIPL in the proangiogenic effects of the tumour necrosis factor-related apoptosis-inducing ligand (TRAIL).
24398693 2014 The C-terminal domain of the long form of cellular FLICE-inhibitory protein (c-FLIPL) inhibits the interaction of the caspase 8 prodomain with the receptor-interacting protein 1 (RIP1) death domain and regulates caspase 8-dependent nuclear factor ?B (NF-?B) activation.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24355299 2014 Evidence of complex formation between FADD and c-FLIP death effector domains for the death inducing signaling complex.
24005232 2013 Absence of FLICE-inhibitory protein is a novel independent prognostic marker for very short survival in pancreatic ductal adenocarcinoma.
23853530 2013 Dual silencing of Hsp27 and c-FLIP enhances doxazosin-induced apoptosis in PC-3 prostate cancer cells.
23696271 2013 Some mechanisms of FLIP expression in inhibition of HIV-1 replication in Jurkat cells, CD4+ T cells and PBMCs.
23615398 2013 Monensin, a polyether ionophore antibiotic, overcomes TRAIL resistance in glioma cells via endoplasmic reticulum stress, DR5 upregulation and c-FLIP downregulation.
23541952 2013 Control of autophagic cell death by caspase-10 in multiple myeloma.
23519470 2013 Novel phosphorylation and ubiquitination sites regulate reactive oxygen species-dependent degradation of anti-apoptotic c-FLIP protein.
23518915 2013 Cellular FLICE-like inhibitory protein long form (c-FLIPL) overexpression is related to cervical cancer progression.
23483900 2013 HBx-induced NF-?B signaling in liver cells is potentially mediated by the ternary complex of HBx with p22-FLIP and NEMO.
23371318 2013 ERK controls epithelial cell death receptor signalling and cellular FLICE-like inhibitory protein (c-FLIP) in ulcerative colitis.
23322903 2013 The FLIP Side of Life.
23319802 2013 mTOR complex 2 is involved in regulation of Cbl-dependent c-FLIP degradation and sensitivity of TRAIL-induced apoptosis.
23255321 2013 Expression of c-FLIP in pulmonary metastases in osteosarcoma patients and human xenografts.
23247197 2013 Ku70 acetylation and modulation of c-Myc/ATF4/CHOP signaling axis by SIRT1 inhibition lead to sensitization of HepG2 cells to TRAIL through induction of DR5 and down-regulation of c-FLIP.
23235765 Expression and mutation analyses of Fas, FLIP and Bcl-2 in granulosa cell tumor of ovary.
23230268 2013 Type I interferons induce apoptosis by balancing cFLIP and caspase-8 independent of death ligands.
23167276 2013 Prognostic and therapeutic relevance of c-FLIP in acute myeloid leukaemia.
23028678 2012 Predictive value of Sp1/Sp3/FLIP signature for prostate cancer recurrence.
22948392 2013 Suppression of HSP70 expression sensitizes NSCLC cell lines to TRAIL-induced apoptosis by upregulating DR4 and DR5 and downregulating c-FLIP-L expressions.
22842544 2012 Antimycin A sensitizes cells to TRAIL-induced apoptosis through upregulation of DR5 and downregulation of c-FLIP and Bcl-2.
22781394 2013 FLIP: a flop for execution signals.
22753273 2012 CHOP down-regulates cFLIP(L) expression by promoting ubiquitin/proteasome-mediated cFLIP(L) degradation.
22683265 2012 Stoichiometry of the CD95 death-inducing signaling complex: experimental and modeling evidence for a death effector domain chain model.
22504646 2012 Autocrine TNF is critical for the survival of human dendritic cells by regulating BAK, BCL-2, and FLIPL.
22393362 2012 Inhibition of the intrinsic but not the extrinsic apoptosis pathway accelerates and drives MYC-driven tumorigenesis towards acute myeloid leukemia.
22345097 2012 The novel Akt inhibitor API-1 induces c-FLIP degradation and synergizes with TRAIL to augment apoptosis independent of Akt inhibition.
22288650 2012 Ro52/SSA sensitizes cells to death receptor-induced apoptosis by down-regulating c-FLIP(L).
22266862 2012 Histone deacetylase inhibitors sensitize glioblastoma cells to TRAIL-induced apoptosis by c-myc-mediated downregulation of cFLIP.
22219201 2012 Tumor necrosis factor (TNF) receptor-associated factor 7 is required for TNF?-induced Jun NH2-terminal kinase activation and promotes cell death by regulating polyubiquitination and lysosomal degradation of c-FLIP protein.
22190004 2011 The role of c-FLIP splice variants in urothelial tumours.
22126763 2011 [Changes of death receptor regulator expression in the articular cartilage of patients with Kashin-Beck disease].
22072062 2012 ER stress sensitizes cells to TRAIL through down-regulation of FLIP and Mcl-1 and PERK-dependent up-regulation of TRAIL-R2.
22027693 2012 A systems biology approach identifies SART1 as a novel determinant of both 5-fluorouracil and SN38 drug resistance in colorectal cancer.
21912376 2012 Reduced CaM/FLIP binding by a single point mutation in c-FLIP(L) modulates Fas-mediated apoptosis and decreases tumorigenesis.
21868755 2011 Celecoxib promotes c-FLIP degradation through Akt-independent inhibition of GSK3.
21856935 2011 Antioxidant c-FLIP inhibits Fas ligand-induced NF-kappaB activation in a phosphatidylinositol 3-kinase/Akt-dependent manner.
21803845 2011 PMLRAR? binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21737330 2011 cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.
21691254 2011 Flice inhibitory protein is associated with the survival of neonatal neutrophils.
21638304 2012 Cellular (FLICE) like inhibitory protein (cFLIP) expression in diffuse large B-cell lymphoma identifies a poor prognostic subset, but fails to predict the molecular subtype.
21562857 2011 Inhibition of cellular FLICE-like inhibitory protein abolishes insensitivity to interferon-? and death receptor stimulation in resistant variants of the human U937 cell line.
21525012 2011 Epidermal growth factor receptor-mediated tissue transglutaminase overexpression couples acquired tumor necrosis factor-related apoptosis-inducing ligand resistance and migration through c-FLIP and MMP-9 proteins in lung cancer cells.
21480219 2012 Pharmacologic downregulation of c-FLIP(L) restores juxtacrine death receptor-mediated apoptosis in cancer cells in a peritoneal carcinomatosis model.
21454681 2011 Cellular FLICE-inhibitory protein (cFLIP) isoforms block CD95- and TRAIL death receptor-induced gene induction irrespective of processing of caspase-8 or cFLIP in the death-inducing signaling complex.
21435442 2011 KSR1 is overexpressed in endometrial carcinoma and regulates proliferation and TRAIL-induced apoptosis by modulating FLIP levels.
21403465 2011 Silencing FLIP(L) modifies TNF-induced apoptotic protein expression.
21324892 2011 Modeling reveals that dynamic regulation of c-FLIP levels determines cell-to-cell distribution of CD95-mediated apoptosis.
21307400 2010 FLIP regulation of HO-1 and TNF signalling in human acute myeloid leukemia provides a unique secondary anti-apoptotic mechanism.
21153369 2011 Regulation of cell death by c-FLIP phosphorylation.
21107885 2012 Itch/AIP4-independent proteasomal degradation of cFLIP induced by the histone deacetylase inhibitor SAHA sensitizes breast tumour cells to TRAIL.
21071136 2013 Targeting c-FLIP in cancer.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20975036 2010 Cellular FLICE-inhibitory protein protects against cardiac remodeling induced by angiotensin II in mice.
20882347 2011 Triggering of death receptor apoptotic signaling by human papillomavirus 16 E2 protein in cervical cancer cell lines is mediated by interaction with c-FLIP.
20876774 2011 Identification of c-FLIP(L) and c-FLIP(S) as critical regulators of death receptor-induced apoptosis in pancreatic cancer cells.
20812013 2010 [cFLIP diminishes CD95-induced apoptosis of CD30-stimulated cutaneous anaplastic large T cell lymphoma (cALCL) cells].
20802294 2010 Polymorphism in tumor necrosis factor-related apoptosis-inducing ligand receptor 1 is associated with poor viral response to interferon-based hepatitis C virus therapy in HIV/hepatitis C virus-coinfected individuals.
20696707 2010 Model-based dissection of CD95 signaling dynamics reveals both a pro- and antiapoptotic role of c-FLIPL.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595005 2010 Programmed cell death 4 (PDCD4) mediates the sensitivity of gastric cancer cells to TRAIL-induced apoptosis by down-regulation of FLIP expression.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20561424 2010 [Gene expression in patients with myelodysplastic syndrome].
20508645 2010 c-FLIPL enhances anti-apoptotic Akt functions by modulation of Gsk3? activity.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20449949 2010 Expression of FLICE-inhibitory protein in synovial tissue and its association with synovial inflammation in juvenile idiopathic arthritis.
20372864 2010 Inhibition of c-FLIP expression by miR-512-3p contributes to taxol-induced apoptosis in hepatocellular carcinoma cells.
20335528 2010 Expression of cellular FLIP by B cells is required for their participation in an immune response.
20227749 2010 The role of c-FLIP(L) in ovarian cancer: chaperoning tumor cells from immunosurveillance and increasing their invasive potential.
20224598 2010 The antiapoptotic protein, FLIP, is regulated by heterogeneous nuclear ribonucleoprotein K and correlates with poor overall survival of nasopharyngeal carcinoma patients.
20218968 2010 c-FLIP is involved in erythropoietin-mediated protection of erythroid-differentiated cells from TNF-alpha-induced apoptosis.
20087343 2010 Early growth response-1 is a regulator of DR5-induced apoptosis in colon cancer cells.
20016063 2010 Modulation of Wnt signaling by the nuclear localization of cellular FLIP-L.
19956887 2010 The sesquiterpene lactone eupatolide sensitizes breast cancer cells to TRAIL through down-regulation of c-FLIP expression.
19949310 2010 Downregulation of c-FLIP, XIAP and Mcl-1 protein as well as depletion of reduced glutathione contribute to the apoptosis induction of glycyrrhetinic acid derivatives in leukemia cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906927 2010 Herpes simplex virus type 1 (HSV-1)-induced apoptosis in human dendritic cells as a result of downregulation of cellular FLICE-inhibitory protein and reduced expression of HSV-1 antiapoptotic latency-associated transcript sequences.
19896469 2010 AMPK-independent down-regulation of cFLIP and sensitization to TRAIL-induced apoptosis by AMPK activators.
19890350 2010 Resistance of cutaneous anaplastic large-cell lymphoma cells to apoptosis by death ligands is enhanced by CD30-mediated overexpression of c-FLIP.
19816511 2010 Altered thymic selection by overexpressing cellular FLICE inhibitory protein in T cells causes lupus-like syndrome in a BALB/c but not C57BL/6 strain.
19802016 2010 Akt promotes chemoresistance in human ovarian cancer cells by modulating cisplatin-induced, p53-dependent ubiquitination of FLICE-like inhibitory protein.
19798106 2010 Radiation and anticancer drugs can facilitate mitochondrial bypass by CD95/Fas via c-FLIP downregulation.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19734124 2008 Cancer cells with high expression of CD133 exert FLIP upregulation and resistance to TRAIL-induced apoptosis.
19728335 2010 High expression levels of IKKalpha and IKKbeta are necessary for the malignant properties of liver cancer.
19710364 2009 Mind bomb 1 regulation of cFLIP interactions.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19543235 2009 Procaspase 8 overexpression in non-small-cell lung cancer promotes apoptosis induced by FLIP silencing.
19476635 2009 Expressions of IGFBP-5, cFLIP in cervical intraepithelial neoplasia, cervical carcinoma and their clinical significances: a molecular pathology.
19439735 2009 A single nucleotide polymorphism determines protein isoform production of the human c-FLIP protein.
19433309 Nuclear localization of c-FLIP-L and its regulation of AP-1 activity.
19409438 2009 The XIAP inhibitor Embelin enhances TRAIL-mediated apoptosis in malignant glioma cells by down-regulation of the short isoform of FLIP.
19398149 2009 Myricetin sensitizes malignant glioma cells to TRAIL-mediated apoptosis by down-regulation of the short isoform of FLIP and bcl-2.
19372246 2010 Compartmentalized expression of c-FLIP in lung tissues of patients with idiopathic pulmonary fibrosis.
19363595 2009 c-FLIPL regulates PKC via AP-2 to inhibit Bax-mediated apoptosis induced by HIV-1 gp120 in Jurkat cells.
19343040 2009 PKC-mediated phosphorylation regulates c-FLIP ubiquitylation and stability.
19339247 2009 Activation-induced degradation of FLIP(L) is mediated via the phosphatidylinositol 3-kinase/Akt signaling pathway in macrophages.
19321593 2009 c-FLIPL expression defines two ovarian cancer patient subsets and is a prognostic factor of adverse outcome.
19282655 2009 Over-expression of c-FLIP confers the resistance to TRAIL-induced apoptosis on gallbladder carcinoma.
19249545 Adenovirus-mediated gene expression of the human c-FLIP(L) gene protects pig islets against human CD8(+) cytotoxic T lymphocyte-mediated cytotoxicity.
19243385 2009 Knockdown of c-FLIP(L) enhanced AD5-10 anti-death receptor 5 monoclonal antibody-induced apoptosis in human lung cancer cells.
19223508 2009 Involvement of FLIP in 2-methoxyestradiol-induced tumor regression in transgenic adenocarcinoma of mouse prostate model.
19203346 2009 Sensitization of imatinib-resistant CML cells to TRAIL-induced apoptosis is mediated through down-regulation of Bcr-Abl as well as c-FLIP.
19177145 2009 Suprabasal spongiosis in acute eczematous dermatitis: cFLIP maintains resistance of basal keratinocytes to T-cell-mediated apoptosis.
19161534 2009 Immunohistochemical analysis of Fas and FLIP in prostate cancers.
19115040 2009 Activation by C5a of endothelial cell caspase 8 and cFLIP.
19109151 2009 A role for cFLIP in B cell proliferation and stress MAPK regulation.
19090833 2008 Interaction between cFLIP and Itch, a ubiquitin ligase, is obstructed in Trypanosoma cruzi-infected human cells.
18840411 2008 c-FLIP knockdown induces ligand-independent DR5-, FADD-, caspase-8-, and caspase-9-dependent apoptosis in breast cancer cells.
18838202 2008 Differential responses of FLIPLong and FLIPShort-overexpressing human myeloid leukemia cells to TNF-alpha and TRAIL-initiated apoptotic signals.
18823309 2008 Association of polymorphisms in CASP10 and CASP8 with FEV(1)/FVC and bronchial hyperresponsiveness in ethnically diverse asthmatics.
18820704 2009 Combined inhibition of FLIP and XIAP induces Bax-independent apoptosis in type II colorectal cancer cells.
18767116 2008 Overexpression of cFLIPs inhibits oxaliplatin-mediated apoptosis through enhanced XIAP stability and Akt activation in human renal cancer cells.
18726983 2008 Induction of FLIP expression by androgens protects prostate cancer cells from TRAIL-mediated apoptosis.
18603835 2008 cFLIP regulates death receptor-mediated apoptosis in an ovarian granulosa cell line by inhibiting procaspase-8 cleavage.
18593367 2008 CD4+T cells in CIKs (CD4+ CIKs) reversed resistance to fas-mediated apoptosis through CD40/CD40L ligation rather than IFN-gamma stimulation.
18509086 2008 Up-regulation of c-FLIP short by NFAT contributes to apoptosis resistance of short-term activated T cells.
18414015 2008 C-FLIP promotes the motility of cancer cells by activating FAK and ERK, and increasing MMP-9 expression.
18398344 2008 c-Flip overexpression reduces cardiac hypertrophy in response to pressure overload.
18391984 2008 FOXO3a mediates the androgen-dependent regulation of FLIP and contributes to TRAIL-induced apoptosis of LNCaP cells.
18339897 2008 Synergistic interactions between interferon-gamma and TRAIL modulate c-FLIP in endothelial cells, mediating their lineage-specific sensitivity to thrombotic thrombocytopenic purpura plasma-associated apoptosis.
18314443 2008 Resistance to FasL and tumor necrosis factor-related apoptosis-inducing ligand-mediated apoptosis in Sezary syndrome T-cells associated with impaired death receptor and FLICE-inhibitory protein expression.
18264131 2008 Gli2 upregulates cFlip and renders basal cell carcinoma cells resistant to death ligand-mediated apoptosis.
18257744 2008 Calmodulin binding to cellular FLICE-like inhibitory protein modulates Fas-induced signalling.
18243739 2008 Critical role for c-FLIP(L) on Fas resistance in colon carcinoma cell line HT-29.
18202225 2008 HO-1 underlies resistance of AML cells to TNF-induced apoptosis.
18189268 2008 Sanguinarine-induced apoptosis: generation of ROS, down-regulation of Bcl-2, c-FLIP, and synergy with TRAIL.
18084329 2008 Suppression of cFLIP is sufficient to sensitize human melanoma cells to TRAIL- and CD95L-mediated apoptosis.
18073330 2008 NF-kappaB-dependent expression of the antiapoptotic factor c-FLIP is regulated by calpain 3, the protein involved in limb-girdle muscular dystrophy type 2A.
17988665 2008 Interferon-alpha induces transient upregulation of c-FLIP through NF-kappaB activation.
17982483 2008 CK2 controls TRAIL and Fas sensitivity by regulating FLIP levels in endometrial carcinoma cells.
17932249 2008 ATM kinase activity modulates Fas sensitivity through the regulation of FLIP in lymphoid cells.
17922291 2008 Overexpression of cFLIP in head and neck squamous cell carcinoma and its clinicopathologic correlations.
17912957 2007 Inhibition of apoptosis by expression of antiapoptotic proteins in recombinant human keratinocytes.
17762208 2007 Antioxidant status alters levels of Fas-associated death domain-like IL-1B-converting enzyme inhibitory protein following neonatal hypoxia-ischemia.
17726263 2007 Independent induction of caspase-8 and cFLIP expression during colorectal carcinogenesis in sporadic and HNPCC adenomas and carcinomas.
17697742 2007 Valproic acid induces apoptosis in chronic lymphocytic leukemia cells through activation of the death receptor pathway and potentiates TRAIL response.
17659339 2008 Bortezomib induces caspase-dependent apoptosis in Hodgkin lymphoma cell lines and is associated with reduced c-FLIP expression: a gene expression profiling study with implications for potential combination therapies.
17646662 2007 Elevated NF-kappaB responses and FLIP levels in leukemic but not normal lymphocytes: reduction by salicylate allows TNF-induced apoptosis.
17638906 2007 Lipid rafts and nonrafts mediate tumor necrosis factor related apoptosis-inducing ligand induced apoptotic and nonapoptotic signals in non small cell lung carcinoma cells.
17581950 2007 FLIP(L) protects neurons against in vivo ischemia and in vitro glucose deprivation-induced cell death.
17573774 2007 Impairment of the ubiquitin-proteasome system by cellular FLIP.
17559541 2007 c-FLIP expression in colorectal carcinomas: association with Fas/FasL expression and prognostic implications.
17513603 2007 Cellular FLICE-inhibitory protein regulates chemotherapy-induced apoptosis in breast cancer cells.
17450141 2007 A six-nucleotide insertion-deletion polymorphism in the CASP8 promoter is associated with susceptibility to multiple cancers.
17441421 2007 [Clinical significance and expression of FLIP and PTEN protein in laryngeal squamous cell carcinoma].
17440816 2007 Expression of anti-apoptotic factors modulates Apo2L/TRAIL resistance in colon carcinoma cells.
17376892 2007 Up-regulation of c-FLIPS+R upon CD40 stimulation is associated with inhibition of CD95-induced apoptosis in primary precursor B-ALL.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17272514 2007 cFLIPL prevents TRAIL-induced apoptosis of hepatocellular carcinoma cells by inhibiting the lysosomal pathway of apoptosis.
17159907 2007 Palmitoylation of CD95 facilitates formation of SDS-stable receptor aggregates that initiate apoptosis signaling.
17110930 2006 An antiapoptotic protein, c-FLIPL, directly binds to MKK7 and inhibits the JNK pathway.
17106251 2006 Targeting the short form of cFLIP by RNA interference is sufficient to enhance TRAIL sensitivity in PC3 prostate carcinoma cells.
17070520 2006 Sodium arsenite accelerates TRAIL-mediated apoptosis in melanoma cells through upregulation of TRAIL-R1/R2 surface levels and downregulation of cFLIP expression.
17056549 2006 The immediate early 2 protein of human cytomegalovirus (HCMV) mediates the apoptotic control in HCMV retinitis through up-regulation of the cellular FLICE-inhibitory protein expression.
17047155 2007 Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation.
17003335 2006 Low concentration of interleukin-1beta induces FLICE-inhibitory protein-mediated beta-cell proliferation in human pancreatic islets.
16901543 2007 The CD40-induced protection against CD95-mediated apoptosis is associated with a rapid upregulation of anti-apoptotic c-FLIP.
16740746 2006 FAS death domain deletions and cellular FADD-like interleukin 1beta converting enzyme inhibitory protein (long) overexpression: alternative mechanisms for deregulating the extrinsic apoptotic pathway in diffuse large B-cell lymphoma subtypes.
16720717 2006 Androgen receptor and prostate apoptosis response factor-4 target the c-FLIP gene to determine survival and apoptosis in the prostate gland.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16611896 2006 Hepatitis C virus core protein inhibits tumor necrosis factor alpha-mediated apoptosis by a protective effect involving cellular FLICE inhibitory protein.
16472594 2006 A functional role of flip in conferring resistance of Crohn's disease lamina propria lymphocytes to FAS-mediated apoptosis.
16441226 2006 The role of cellular FLICE inhibitory protein (c-FLIP) in the pathogenesis and treatment of cancer.
16436054 2006 Human T-cell leukemia virus type-I oncoprotein Tax inhibits Fas-mediated apoptosis by inducing cellular FLIP through activation of NF-kappaB.
16403915 2006 HTLV-1 Tax protects against CD95-mediated apoptosis by induction of the cellular FLICE-inhibitory protein (c-FLIP).
16304056 2006 c-FLIP confers resistance to FAS-mediated apoptosis in anaplastic large-cell lymphoma.
16298825 2005 Fas, Fas-associated death domain-like interleukin 1beta-converting enzyme-like inhibitory protein, and apoptotic features of elderly acute myeloid leukemia based on response to induction chemotherapy.
16247474 2006 c-FLIP inhibits chemotherapy-induced colorectal cancer cell death.
16211288 2005 Enhancement of susceptibility to Fas-mediated apoptosis in HL-60 cells through down-regulation of cellular FLICE-inhibitory protein by phosphatidylinositol 3-kinase inhibitors.
16077198 2005 Cycloheximide-mediated sensitization to TNF-alpha-induced apoptosis in human colorectal cancer cell line COLO 205; role of FLIP and metabolic inhibitors.
16052516 2006 PKCdelta-mediated regulation of FLIP expression in human colon cancer cells.
16052233 2006 E2F1 induces apoptosis and sensitizes human lung adenocarcinoma cells to death-receptor-mediated apoptosis through specific downregulation of c-FLIP(short).
16014121 Expression of cellular FLICE/caspase-8 inhibitory protein is associated with malignant potential in endometrial carcinoma.
15956881 2005 Immunohistochemical detection of the apoptosis-related proteins FADD, FLICE, and FLIP in Langerhans cell histiocytosis.
15917295 2005 Trypanosoma cruzi posttranscriptionally up-regulates and exploits cellular FLIP for inhibition of death-inducing signal.
15899875 2005 FLIP protects against hypoxia/reoxygenation-induced endothelial cell apoptosis by inhibiting Bax activation.
15886205 2005 Rapid turnover of c-FLIPshort is determined by its unique C-terminal tail.
15864316 2005 FLIP is frequently expressed in endometrial carcinoma and has a role in resistance to TRAIL-induced apoptosis.
15843523 2005 Cellular FLIP (long form) regulates CD8+ T cell activation through caspase-8-dependent NF-kappa B activation.
15832422 2005 Expression of cellular FLICE-inhibitory protein and its association with p53 mutation in colon cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15815586 2005 Expression of cellular FLICE inhibitory proteins (cFLIP) in normal and traumatic murine and human cerebral cortex.
15761846 2005 Transgenic overexpression of the Caspase-8 inhibitor FLIP(short) leads to impaired T cell proliferation and an increased memory T cell pool after staphylococcal enterotoxin B injection.
15760909 2005 Selective knockdown of the long variant of cellular FLICE inhibitory protein augments death receptor-mediated caspase-8 activation and apoptosis.
15731171 2005 The androgen receptor directly targets the cellular Fas/FasL-associated death domain protein-like inhibitory protein gene to promote the androgen-independent growth of prostate cancer cells.
15722350 2005 Pathway-specific profiling identifies the NF-kappa B-dependent tumor necrosis factor alpha-regulated genes in epidermal keratinocytes.
15701651 2005 ASC-mediated NF-kappaB activation leading to interleukin-8 production requires caspase-8 and is inhibited by CLARP.
15701649 2005 c-FLIPR, a new regulator of death receptor-induced apoptosis.
15686714 2004 Apoptotic death of infiltrating cells in human cardiac allografts is regulated by IL-2, FASL, and FLIP.
15653751 2005 Down-regulation of normal human T cell blast activation: roles of APO2L/TRAIL, FasL, and c- FLIP, Bim, or Bcl-x isoform expression.
15644494 2005 Cross-resistance to death ligand-induced apoptosis in cisplatin-selected HeLa cells associated with overexpression of DDB2 and subsequent induction of cFLIP.
15557152 2004 Cellular FLIP (long isoform) overexpression in T cells drives Th2 effector responses and promotes immunoregulation in experimental autoimmune encephalomyelitis.
15540114 2005 Sensitization of osteosarcoma cells to death receptor-mediated apoptosis by HDAC inhibitors through downregulation of cellular FLIP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485835 2004 Fas-associated protein with death domain (FADD)-independent recruitment of c-FLIPL to death receptor 5.
15459191 2004 cFLIPL inhibits tumor necrosis factor-related apoptosis-inducing ligand-mediated NF-kappaB activation at the death-inducing signaling complex in human keratinocytes.
15354734 2004 Expression of c-FLIP in classic and nodular lymphocyte-predominant Hodgkin lymphoma.
15334061 2004 FLIP overexpression inhibits death receptor-induced apoptosis in malignant mesothelial cells.
15304499 2004 Transduction of the TAT-FLIP fusion protein results in transient resistance to Fas-induced apoptosis in vivo.
15297424 2004 CD95-mediated apoptosis is impaired at receptor level by cellular FLICE-inhibitory protein (long form) in wild-type p53 human ovarian carcinoma.
15273717 2004 Regulation of caspase-6 and FLIP by the AMPK family member ARK5.
15258564 2004 Possible role of FLICE-like inhibitory protein (FLIP) in chemoresistant ovarian cancer cells in vitro.
15183989 2004 c-FLIP expression in bladder urothelial carcinomas: its role in resistance to Fas-mediated apoptosis and clinicopathologic correlations.
15096587 2004 Expression of the cellular FLICE-inhibitory protein (c-FLIP) protects Hodgkin's lymphoma cells from autonomous Fas-mediated death.
15078899 2004 c-FLIP mediates resistance of Hodgkin/Reed-Sternberg cells to death receptor-induced apoptosis.
15024054 2004 N-terminal fragment of c-FLIP(L) processed by caspase 8 specifically interacts with TRAF2 and induces activation of the NF-kappaB signaling pathway.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662022 2003 Upregulation of FLIP(S) by Akt, a possible inhibition mechanism of TRAIL-induced apoptosis in human gastric cancers.
14637155 2003 Long form of cellular FLICE-inhibitory protein interacts with Daxx and prevents Fas-induced JNK activation.
14578361 2004 Phosphatidylinositide 3-kinase priming couples c-FLIP to T cell activation.
14562111 2003 Expression of FLIP(Long) and FLIP(Short) in bone marrow mononuclear and CD34+ cells in patients with myelodysplastic syndrome: correlation with apoptosis.
13679070 2003 Casper/c-FLIP is physically and functionally associated with NF-kappaB1 p105.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12820373 High level of cFLIP correlates with resistance to death receptor-induced apoptosis in bladder carcinoma cells.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12746452 2003 cFLIP-L inhibits p38 MAPK activation: an additional anti-apoptotic mechanism in bile acid-mediated apoptosis.
12727877 2003 Pro-apoptotic function of HBV X protein is mediated by interaction with c-FLIP and enhancement of death-inducing signal.
12716387 2003 Increased expression of FLIP, an inhibitor of Fas-mediated apoptosis, in stomach cancer.
12592338 2003 Constitutively active Akt1 protects HL60 leukemia cells from TRAIL-induced apoptosis through a mechanism involving NF-kappaB activation and cFLIP(L) up-regulation.
12574377 2003 Expression of the long form of human FLIP by retroviral gene transfer of hemopoietic stem cells exacerbates experimental autoimmune encephalomyelitis.
12556488 2003 Erythroid differentiation sensitizes K562 leukemia cells to TRAIL-induced apoptosis by downregulation of c-FLIP.
12552004 2003 E1A sensitizes cells to tumor necrosis factor alpha by downregulating c-FLIP S.
12496482 The FLIP variation on the TRAIL DISC: doxorubicin conducts the swan song.
12496481 Doxorubicin pretreatment sensitizes prostate cancer cell lines to TRAIL induced apoptosis which correlates with the loss of c-FLIP expression.
12496285 2003 Calcium/calmodulin-dependent protein kinase II regulation of c-FLIP expression and phosphorylation in modulation of Fas-mediated signaling in malignant glioma cells.
12477972 2002 Differential sensitivity of endothelial cells of various species to apoptosis induced by gene transfer of Fas ligand: role of FLIP levels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432255 Downregulation of c-FLIP sensitizes DU145 prostate cancer cells to Fas-mediated apoptosis.
12407100 2003 Bile acids stimulate cFLIP phosphorylation enhancing TRAIL-mediated apoptosis.
12393527 2003 Stem cell factor increases the expression of FLIP that inhibits IFNgamma -induced apoptosis in human erythroid progenitor cells.
12215447 2002 The long form of FLIP is an activator of caspase-8 at the Fas death-inducing signaling complex.
12097160 2002 Monitoring of caspase-8/FLICE processing and activation upon Fas stimulation with novel antibodies directed against a cleavage site for caspase-8 and its substrate, FLICE-like inhibitory protein (FLIP).
12060768 2002 FLIP switches Fas-mediated glucose signaling in human pancreatic beta cells from apoptosis to cell replication.
11965497 2002 Death effector domain-containing proteins DEDD and FLAME-3 form nuclear complexes with the TFIIIC102 subunit of human transcription factor IIIC.
11940602 2002 An inducible pathway for degradation of FLIP protein sensitizes tumor cells to TRAIL-induced apoptosis.
11877293 2002 Intracellular regulation of tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis in human multiple myeloma cells.
11830587 2002 The human herpes virus 8-encoded viral FLICE inhibitory protein physically associates with and persistently activates the Ikappa B kinase complex.
11741985 2002 Identification and characterization of DEDD2, a death effector domain-containing protein.
11193041 2000 The complexity of TNF-related apoptosis-inducing ligand.
11161814 2001 Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
10837247 2000 The caspase-8 inhibitor FLIP promotes activation of NF-kappaB and Erk signaling pathways.
10227994 1999 Cell cycle-dependent regulation of FLIP levels and susceptibility to Fas-mediated apoptosis.
10200473 1998 Cell death attenuation by 'Usurpin', a mammalian DED-caspase homologue that precludes caspase-8 recruitment and activation by the CD-95 (Fas, APO-1) receptor complex.
10069390 1999 Identification of caspases that cleave presenilin-1 and presenilin-2. Five presenilin-1 (PS1) mutations do not alter the sensitivity of PS1 to caspases.
9990034 1999 Phosphorylation of presenilin-2 regulates its cleavage by caspases and retards progression of apoptosis.
9880531 1999 The role of c-FLIP in modulation of CD95-induced apoptosis.
9575181 1998 RICK, a novel protein kinase containing a caspase recruitment domain, interacts with CLARP and regulates CD95-mediated apoptosis.
9380701 1997 CLARP, a death effector domain-containing protein interacts with caspase-8 and regulates apoptosis.
9326610 1997 MRIT, a novel death-effector domain-containing protein, interacts with caspases and BclXL and initiates cell death.
9325248 1997 Identification and molecular cloning of two novel receptors for the cytotoxic ligand TRAIL.
9289491 1997 CASH, a novel caspase homologue with death effector domains.
9228018 1997 FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis.
9219695 1997 Alternative cleavage of Alzheimer-associated presenilins during apoptosis by a caspase-3 family protease.
9217161 1997 Inhibition of death receptor signals by cellular FLIP.
9211860 1997 I-FLICE, a novel inhibitor of tumor necrosis factor receptor-1- and CD-95-induced apoptosis.
9208847 1997 Casper is a FADD- and caspase-related inducer of apoptosis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.