Property Summary

NCBI Gene PubMed Count 313
PubMed Score 871.65
PubTator Score 1983.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.139 9.2e-04
adrenocortical carcinoma -1.204 4.0e-04
aldosterone-producing adenoma -1.264 6.1e-03
Amyotrophic lateral sclerosis 1.133 1.5e-05
Bipolar Disorder 1.115 4.6e-02
Breast cancer -1.400 5.3e-11
colon cancer -1.400 1.8e-02
cutaneous lupus erythematosus 1.300 4.0e-04
dermatomyositis -1.400 3.3e-03
Gaucher disease type 1 -1.100 1.6e-02
glioblastoma 1.100 6.0e-03
group 3 medulloblastoma 1.300 2.0e-02
interstitial cystitis 1.200 5.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.6e-03
lung adenocarcinoma -1.100 3.6e-10
lung cancer -2.400 9.7e-05
lung carcinoma -2.100 2.0e-26
malignant mesothelioma -1.400 1.3e-04
non-small cell lung cancer -1.089 4.8e-10
osteosarcoma -1.042 3.2e-03
ovarian cancer -1.500 4.2e-06
pancreatic ductal adenocarcinoma liver m... 1.429 4.2e-03
Pick disease 1.200 9.1e-05
pituitary cancer -1.100 1.5e-05
psoriasis 1.100 2.2e-03
spina bifida -1.675 4.4e-02
ulcerative colitis 1.400 7.2e-07

Protein-protein Interaction (2)

Gene RIF (276)

AA Sequence

MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKR      1 - 70
ILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEK     71 - 140
LNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKE    141 - 210
QRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQK    211 - 280
FLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAG    281 - 350
KPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP    351 - 420
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT              421 - 480
//

Text Mined References (316)

PMID Year Title