Property Summary

NCBI Gene PubMed Count 38
PubMed Score 27.63
PubTator Score 23.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

 GO Function (1)

Gene RIF (24)

PMID Text
26996939 analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover
25814227 Cofilin 2 phosphorylation and genetic overexpression plays a role in the pathogenesis of idiopathic dilated cardiomyopthay.
25502766 The serum lever of Alzheimer's disease were increase and the expression of clf2 strongly correlated with the Mini-Mental State Examination scores of the AD patients
24889065 In primary tumours, both desmin and CFL2 expression predicted improved overall survival in multivariate analyses
24610938 patients with severe nemaline myopathy should be screened for mutations in CFL2.
24023293 study investigated the comparison of the levels of cofilin-1 and cofilin-2 in regressive QR-32 and progressive QRsP-11cells by western blotting
23395798 Studies indicate that cofilin binds actin stoichiometrically - one cofilin molecule per actin filament subunit.
23294842 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
22560515 A novel homozygous missense mutation in exon 2 (c.19G>A, p.Val7Met) of CFL2 was identified in two siblings with congenital myopathy.
22450169 cofilins 1 and 2 only weakly interact with 14-3-3 and therefore cannot directly compete with phosphorylated small heat shock protein HspB6 for its binding to 14-3-3 zeta
22158895 the cofilin-induced change in the filament twist is due to a unique conformation of the actin molecule unrelated to any previously observed state
21894436 Differential expression of up-regulated cofilin-1 and down-regulated cofilin-2 characteristic of pancreatic cancer tissues
20842205 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
20801873 PHD2 affects cell migration and F-actin formation via RhoA/rho-associated kinase-dependent cofilin phosphorylation
20347121 FXa-mediated sustained cofilin inactivation leads to stabilization of actin filaments incompatible with migration
19752190 MLP binds directly to CFL2 in human cardiac and skeletal muscles.
19683683 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
18928553 Resting T cells from infected patients carry significantly higher levels of active cofilin.
18808680 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
18775311 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
17572668 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
17160903 CFL2, encoding the actin-binding protein muscle cofilin-2, is mutated in two siblings with congenital myopathy.
16530787 actin depolymerizing factor/cofilins play an active role in establishing new interprotomer interfaces in F-actin that substitute for disrupted or weakened (as in ADP-actin) longitudinal contacts in filaments
16526095 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin

AA Sequence

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS      1 - 70
FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL     71 - 140
DDIKDRSTLGEKLGGNVVVSLEGKPL                                                141 - 166
//

Text Mined References (46)

PMID Year Title
26996939 2016 TIRF microscopy analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover.
25814227 2015 Cofilin-2 phosphorylation and sequestration in myocardial aggregates: novel pathogenetic mechanisms for idiopathic dilated cardiomyopathy.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
24889065 2015 Progressive loss of myogenic differentiation in leiomyosarcoma has prognostic value.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
24610938 2014 Novel cofilin-2 (CFL2) four base pair deletion causing nemaline myopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023293 2013 Malignant progressive tumor cell clone exhibits significant up-regulation of cofilin-2 and 27-kDa modified form of cofilin-1 compared to regressive clone.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23395798 2013 Biophysics of actin filament severing by cofilin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22560515 2012 Congenital myopathy caused by a novel missense mutation in the CFL2 gene.
22450169 2012 Cofilin weakly interacts with 14-3-3 and therefore can only indirectly participate in regulation of cell motility by small heat shock protein HspB6 (Hsp20).
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22158895 2011 Remodeling of actin filaments by ADF/cofilin proteins.
21894436 2011 Differential expression of up-regulated cofilin-1 and down-regulated cofilin-2 characteristic of pancreatic cancer tissues.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20801873 2010 Prolyl hydroxylase domain (PHD) 2 affects cell migration and F-actin formation via RhoA/rho-associated kinase-dependent cofilin phosphorylation.
20347121 2010 Coagulation Factor Xa inhibits cancer cell migration via LIMK1-mediated cofilin inactivation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19752190 2009 Muscle LIM protein interacts with cofilin 2 and regulates F-actin dynamics in cardiac and skeletal muscle.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18928553 2008 Cofilin activation in peripheral CD4 T cells of HIV-1 infected patients: a pilot study.
17160903 2007 Nemaline myopathy with minicores caused by mutation of the CFL2 gene encoding the skeletal muscle actin-binding protein, cofilin-2.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16530787 2006 Cofilin cross-bridges adjacent actin protomers and replaces part of the longitudinal F-actin interface.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12684437 2003 Control of growth cone motility and morphology by LIM kinase and Slingshot via phosphorylation and dephosphorylation of cofilin.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12049672 2002 The ADF/cofilin family: actin-remodeling proteins.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11809832 2002 The three mouse actin-depolymerizing factor/cofilins evolved to fulfill cell-type-specific requirements for actin dynamics.
11422377 2001 Characterization of human muscle type cofilin (CFL2) in normal and regenerating muscle.
10461190 1999 Putting a new twist on actin: ADF/cofilins modulate actin dynamics.
9655398 1998 Cofilin phosphorylation by LIM-kinase 1 and its role in Rac-mediated actin reorganization.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8824278 1996 Dephosphorylation of serine 3 regulates nuclear translocation of cofilin.
8800436 1996 Mapping of human non-muscle type cofilin (CFL1) to chromosome 11q13 and muscle-type cofilin (CFL2) to chromosome 14.