Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.85
PubTator Score 12.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (13)

PMID Text
27196323 Next-generation sequencing of the CFH region identified putatively functional variants (missense, splice site and indel) on the four common haplotypes. We found no expression of any of the five CFH-related genes in the retina or RPE/Choroid/Sclera, in contrast to the liver, which is the main source of the circulating proteins. [CFHR4]
25979655 Studies indicate that complement factor H-related proteins (FHR1-5) may enhance complement activation, with important implications for the role of these proteins in disease.
22518841 Factor H-related protein 4 activates complement by serving as a platform for the assembly of alternative pathway C3 convertase via its interaction with C3b protein
21637784 Systemic lupus erythematosus were detected in European Americans and African Americans, which could be attributed to an intronic complement regulator factor H (CFH) single nucleotide polymorphism (SNP) and an intergenic SNP between CFHR1 and CFHR4.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20181037 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20059470 Observational study of gene-disease association. (HuGE Navigator)
20042240 These data reveal the molecular basis of the specific interaction of CFHR4 with native CRP and suggest a role for CFHR4 in enhancing opsonization via CRP binding.
19861685 Association of factor H autoantibodies with deletions of CFHR1, CFHR3, CFHR4, and with mutations in CFH, CFI, CD46, and C3 in patients with atypical hemolytic uremic syndrome.
19084272 These data identify CFHR4 as a novel ligand for native CRP, and suggest a role for CFHR4 in opsonization of necrotic cells.
18541031 Observational study of gene-disease association. (HuGE Navigator)
17438673 Observational study of gene-disease association. (HuGE Navigator)
15562282 FHR-4A is a new Factor H-related protein with a unique domain composition, that is an internal duplication of four CCP domains FHR-4A provides the first evidence for alternative splicing among Factor H-related genes.

AA Sequence

MLLLINVILTLWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNFVTPSGSYWDY      1 - 70
IHCTQDGWSPTVPCLRTCSKSDVEIENGFISESSSIYILNEETQYNCKPGYATAEGNSSGSITCLQNGWS     71 - 140
TQPICIKFCDMPVFENSRAKSNGMWFKLHDTLDYECYDGYESSYGNTTDSIVCGEDGWSHLPTCYNSSEN    141 - 210
CGPPPPISNGDTTSFPQKVYLPWSRVEYQCQSYYELQGSKYVTCSNGDWSEPPRCISMKPCEFPEIQHGH    211 - 280
LYYENTRRPYFPVATGQSYSYYCDQNFVTPSGSYWDYIHCTQDGWLPTVPCLRTCSKSDIEIENGFISES    281 - 350
SSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICIKFCDMPVFENSRAKSNGMRFKLHDTLD    351 - 420
YECYDGYEISYGNTTGSIVCGEDGWSHFPTCYNSSEKCGPPPPISNGDTTSFLLKVYVPQSRVEYQCQSY    421 - 490
YELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCKLGYNANTSV    491 - 560
LSFQAVCREGIVEYPRCE                                                        561 - 578
//

Text Mined References (24)

PMID Year Title
27196323 2016 Sequence and Expression of Complement Factor H Gene Cluster Variants and Their Roles in Age-Related Macular Degeneration Risk.
25979655 2015 Factor H-related proteins determine complement-activating surfaces.
23577725 2013 Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
23381943 2013 Ischemic stroke is associated with the ABO locus: the EuroCLOT study.
22518841 2012 Factor H-related protein 4 activates complement by serving as a platform for the assembly of alternative pathway C3 convertase via its interaction with C3b protein.
21637784 2011 Association of genetic variants in complement factor H and factor H-related genes with systemic lupus erythematosus susceptibility.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20181037 2010 Incorporating prior knowledge to facilitate discoveries in a genome-wide association study on age-related macular degeneration.
20059470 2010 Epidemiological approach to identifying genetic predispositions for atypical hemolytic uremic syndrome.
20042240 2010 Molecular basis of C-reactive protein binding and modulation of complement activation by factor H-related protein 4.
19861685 2010 Association of factor H autoantibodies with deletions of CFHR1, CFHR3, CFHR4, and with mutations in CFH, CFI, CD46, and C3 in patients with atypical hemolytic uremic syndrome.
19084272 2009 Human complement factor H-related protein 4 binds and recruits native pentameric C-reactive protein to necrotic cells.
18541031 2008 The NEI/NCBI dbGAP database: genotypes and haplotypes that may specifically predispose to risk of neovascular age-related macular degeneration.
17438673 2006 Extended haplotypes in the complement factor H (CFH) and CFH-related (CFHR) family of genes protect against age-related macular degeneration: characterization, ethnic distribution and evolutionary implications.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15562282 2005 FHR-4A: a new factor H-related protein is encoded by the human FHR-4 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10622723 1999 Functional properties of complement factor H-related proteins FHR-3 and FHR-4: binding to the C3d region of C3b and differential regulation by heparin.
10380701 1999 A radiation hybrid map of complement factor H and factor H-related genes.
9476126 1997 Biochemical and functional characterization of the factor-H-related protein 4 (FHR-4).
9038172 1997 The human factor H-related protein 4 (FHR-4). A novel short consensus repeat-containing protein is associated with human triglyceride-rich lipoproteins.