Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.09
PubTator Score 7.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 0.9
Disease Target Count Z-score Confidence
Age related macular degeneration 72 0.0 5.0
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 3.716 1.9

Expression

Gene RIF (9)

AA Sequence

MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI      1 - 70
TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC     71 - 140
RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS    141 - 210
QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK              211 - 270
//

Text Mined References (19)

PMID Year Title