Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.34
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Tetralogy of Fallot 63 3.74 1.9

AA Sequence

MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGP      1 - 70
EEPLPYSWAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCR     71 - 140
CIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRE    141 - 210
RRPCGRPGLGHRL                                                             211 - 223
//

Text Mined References (2)

PMID Year Title