Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 8.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Disease Target Count
malignant mesothelioma 3232
Disease Target Count P-value
psoriasis 6694 1.8e-35
ependymoma 4679 5.8e-13
nasopharyngeal carcinoma 1058 8.2e-09
chronic rhinosinusitis 512 2.3e-02

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.659 2.3e-02
ependymoma 3.000 5.8e-13
nasopharyngeal carcinoma -2.200 8.2e-09
psoriasis 1.300 1.8e-35

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTAL      1 - 70
GLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMD     71 - 140
AVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQ    141 - 210
ILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQRE    211 - 280
QEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAR    281 - 350
EAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENARKKMETEAEL    351 - 420
RKSRLEQVAFKEHALAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKEV    421 - 490
QNRIATFEEGRRLKEEAQKRRERIDEIKRKKLEELRATGLPEKYCIEAERKANILPATSVN             491 - 551
//

Text Mined References (10)

PMID Year Title