Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung carcinoma 317 1.1e-18
ependymoma 4679 4.4e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 76 4.433 2.2
Male infertility 206 3.093 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.900 4.4e-06
non-small cell lung carcinoma -1.100 1.1e-18

AA Sequence

MAQNVYGPGVRIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKV      1 - 70
MLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQV     71 - 140
LRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWQAAFPDPQLRLEYEGFP    141 - 210
VPANAKILINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVTGNPRDASSSMLD    211 - 280
LPKPPTEDTRAMEQAMGLDTQ                                                     281 - 301
//

Text Mined References (5)

PMID Year Title