Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.18
PubTator Score 2.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.4e-10
nasopharyngeal carcinoma 1056 3.8e-07
Disease Target Count Z-score Confidence
Facial paralysis 15 3.0 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 3.100 5.4e-10
nasopharyngeal carcinoma -1.400 3.8e-07

Gene RIF (1)

PMID Text
22011669 We confirmed that the expression of CCDC37 in squamous cell carcinoma is regulated by DNA methylation of its specific promoter region.

AA Sequence

MSEIPSTIVSKNMTNDKNSLESMNISSSSSTEENPKKQARKNEEHGPDPSANPFHLSGDVDFFLLRDQER      1 - 70
NKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKLTLTKE     71 - 140
KNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLATKEEARLERAEKSLEKDAALFDEFVRENDCS    141 - 210
SVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHS    211 - 280
FLKKAKEVSEASKESSVNSTPGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQ    281 - 350
PSESSGGDSRGSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSH    351 - 420
TLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLESLNCKVLDVYR    421 - 490
HCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKERRIRLREEKLQMQKILQEEHL    491 - 560
QRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMDKEEEELLFFFT                       561 - 611
//

Text Mined References (5)

PMID Year Title
23569216 2013 The MIA complex is a conserved and novel dynein regulator essential for normal ciliary motility.
22011669 2012 Genome-wide analysis of DNA methylation and the gene expression change in lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.