Property Summary

NCBI Gene PubMed Count 571
PubMed Score 317.51
PubTator Score 1517.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis 1.257 5.8e-04
osteosarcoma -3.326 5.0e-09
medulloblastoma, large-cell 1.100 1.2e-03
pancreatic ductal adenocarcinoma liver m... -1.442 6.3e-03
interstitial cystitis 1.400 9.2e-04
ductal carcinoma in situ -1.800 2.5e-02
ovarian cancer 1.200 9.3e-08

Gene RIF (625)

PMID Text
26829743 No significant difference was found in the CETP gene I405V and D442G genotypes between the cerebral hemorrhage patients and controls.
26758205 CETP per se has no impact on the glucose tolerance and tissue uptake, global insulin sensitivity and beta cell insulin secretion rates.
26694435 The polymorphism of CETP genes rs708272, rs3764261, rs1800775, rs711752, rs12149545 was closely related to the dyslipidemia in the Xinjiang Uyghur and Kazakh ethnic groups; and the rs708272 T, rs3764261 T, rs711752 A, and rs12149545 A alleles could reduce risk of dyslipidemia in the Uyghur and Kazakh populations, however, the rs1800775 C allele showed risk factors
26683795 results point out that in addition to the common CETP variants, rare genetic variants in the CETP gene also contribute to the phenotypic variation of HDL-C in the general population
26642708 circulating CETP and Lp-PLA2 might partly play a role in the atherogenic disturbances in patients with iron deficiency anemia through increased susceptibility to lipid peroxidation
26503844 The cholesteryl ester transfer protein (CETP) rs3764261 variant was significantly associated with an increased risk of AMD
26370976 our results show the involvement of the variants of ESR1, LPL and CETP genes in metabolic events related to MetS or some of its features.
26318399 Presence of CETP SNP rs3764261 is not associated with insulin resistance and incident T2DM in patients with clinically manifest vascular disease
26313355 CETP can protect against the obesity-induced impairment in exercise capacity and may be a target to improve exercise capacity in the context of obesity
26261636 SNPs in SORT1, CETP and GCKR were individually associated with lipid level variations in Algerian population.
26253899 Study suggests that the II genotype of the CETP I405V polymorphism is associated with significant abnormalities in gray matter microstructure compared to those with a V405 allele
26244602 Cholesteryl ester transfer protein facilitates the exchange of triglycerides from TG-rich VLDL-1 particles for cholesteryl esters from high-density lipoprotein (HDL) particles.
26203075 decreased triglyceride content of CETP-deficient cells arises from the reduced conversion of DG to TG in the ER and/or on the lipid droplet surface, and enhanced TG degradation in the ER due to its ineffective transport from this organelle.
26101956 polymorphisms in CETP protect HIV-infected patients from developing atherogenic dyslipidemia in a dose-dependent manner
26061659 Although opposing effects suggest that regulation of CETP expression could vary between tissues, the minor allele of rs247616 and single nucleotide polymorphisms in high linkage with it were found to be associated with reduced expression.
26014924 CETP TaqIB and ApoE polymorphisms may not be considered as genetic risk factors for MetS in a Southern Thai population. epsilon4 allele, associated with one metabolic component, low HDL-C levels, might predispose the subjects to develop metabolic disturbances.
25737239 Data indicate that the high-density lipoproteins (HDL) surface lipid curvature generates a hydrophobic environment, leading to cholesteryl ester transfer protein (CETP) hydrophobic distal end interaction.
25725138 B2 allele is associated with higher concentrations of HDL-C and lower concentrations of CETP, which confer a protective effect on coronary artery disease.
25696989 There are no differences in the enzymatic activity of CETP among the carriers of different genotypes.
25606668 Gene-environment interactions studies found significance association between selenium and rs2290201 in FABP4 for total and LDL cholesterol levels and rs1800774 in CETP for elevated LDL cholesterol.
25593327 These data show that overexpression of full-length CETP disrupts lipid homeostasis resulting in the formation of smaller, more metabolically active lipid droplets.
25579610 We demonstrate a significant association of LPL and CETP polymorphisms with serum triglycerides and HDL-cholesterol.
25561046 findings demonstrate that the long-term genetically reduced circulating CETP might be causally associated with the low risk of CHD.
25548261 study provides replicable evidence that individuals with the CETP rs3764261 CC genotype might derive greater effects on raising HDL cholesterol and lowering triglycerides by choosing a low-carbohydrate/high-fat weight-loss diet instead of a low-fat diet.
25547030 The aim of this study was to investigate the influence of genetic polymorphism of CETP gene polymorphism -629C/A on the therapeutic effect of atorvastatin and clinical outcome in Han Chinese patients with coronary heart disease.
25474428 Results suggest the B2B2 genotype of the cholesteryl ester transfer protein TaqIB polymorphism is a protective factor against the development of myocardial infarction.
25463120 increased CETP activity during acute phase of STEMI is independently associated with endothelial dysfunction and adverse clinical outcome
25449063 The phospholipid matrix in discoidal HDL may underlie CETP activity through the self-association, diffusivity and location of cholesteryl ester in the bilayer
25424006 novel atomistic details of the CETP-HDL interaction mechanism
25366166 The overall comparison of the B2 allele with the B1 allele of cholesteryl ester transfer protein yielded a significant risk reduction of coronary artery disease with substantial between-study heterogeneity.
25341944 Data from Brazilian family with familial apoA-I deficiency with nonsense mutation at codon -2 of APOA1 (apolipoprotein A-I) suggest plasma CETP activity is significantly increased in both homozygotes and heterozygotes versus control subjects.
25288221 TaqIB (rs708272) polymorphism modifies association between alcohol and coronary heart disease
25260850 CETP I405V (rs5882) is associated with cognitive function and late-onset Alzheimer's disease risk.
25201589 cholesterol may competitively inhibit cholesteryl ester binding to the CETP molecule, with triglyceride binding being largely undisturbed.
25134189 Variants with CETP conferred susceptibility to CAD in overweight individuals.
25115339 Polymorphisms of the cholesteryl ester transfer protein gene is associated with abdominal obesity.
25110219 genetic polymorphism is associated with coronary artery disease in Egyptians
25105518 A meta-analysis found that individuals with the CETP rs5882 A>G polymorphism were found to have a higher risk of developing Alzheimer's disease.
25073458 The CETP gene TaqIB polymorphism B2B2 genotype was associated with higher levels of serum HDL cholesterol and a more favorable lipid profile.
24997672 Its single nucleotide polymorphism implicated in brain diseases including Alzheimer's disease.
24746832 Data (including data from studies in transgenic mice) suggest expression of CETP in liver can be regulated by dietary factors; here, supplementation with fish oil up-regulates expression of CETP in liver and has hypolipidemic affects.
24746514 Gene-gene interaction between CETP and APOE polymorphisms confers higher risk for hypertriglyceridemia in oldest-old Chinese women.
24737438 the CETP TaqIB polymorphism is associated with the lipid-lowering effect of atorvastatin in patients with CHD.
24659026 Identify novel associations between elevated CETP activity and quantitative/qualitative lipoprotein abnormalities in the atherogenic dyslipidemia in South Asians, a major contributor of increased atherosclerotic cardiovascular diseases in South Asians.
24634116 Results conclude that the R451Q polymorphisms in the CETP gene had no effects on blood lipid levels and are not a risk factor for CHD in Han and Uyghur Chinese.
24615107 The presence of the B1B1 polymorphism of the Taq1B CETP genotype contributes to the development of atrial fibrillation in the Han and Kazak populations in western China
24574346 The ability of apoC1 to inhibit CETP activity is impaired in patients with diabetes. Glycation of apoC1 leads to a change in its electrostatic properties that might account, at least in part, for a loss of constitutive CETP inhibition and an increase in plasma CETP activity in patients with diabetes.
24533069 CETP rs708272 (C>T) and rs1800775 (C>A) polymorphisms may contribute to myocardial infarction susceptibility [meta-analysis]
24530617 A novel mechanism of lipid transfer carried out by CETP.
24498989 Our data suggested that the allele A in rs3764261 in CETP gene may be associated with a decreased risk of advanced AMD in Chinese population.
24468472 There is an association between its polymorphism and the risk of Alzheimer's disease in the Asian populations with APOE+.
24402318 CETP polymorphisms may influence plasma lipid levels in Greek men with coronary heart having BMI variations
24393849 The minor T allele of rs5883 enhanced splicing significantly in two cell lines whereas the minor C allele of rs9930761 did not.
24393350 Our results showed that CETP is a susceptibility gene for neovascular age-related macular degeneration and polypoidal choroidal vasculopathy (PCV) and that ABCG1 a putative gene for PCV.
24388961 Abnormal HDL caused by CETP-deficiency retards this process and thereby protects the patients from development of hepatic lesions. S. japonicum infection is a potential screening factor for high prevalence of CETP deficiency in East Asia.
24376512 The present study identified a multiplier effect from a polymorphism in CETP with ABCA1, APOA1, and SR-B1, as well as a dose-dependence according to the number of alleles present.
24283500 CETP rs708272 polymorphism may be associated with the risk of coronary atherosclerosis in the Chinese.
24242673 There is likely no association of the CETP gene promoter polymorphisms with longevity, at least among Han Chinese.
24204732 Studies indicate that cholesteryl ester transfer protein (CETP) inhibitors therapy is associated with significant increase in HDL-c and decrease in triglyceride and LDL-c with satisfactory safety and tolerability in dyslipidemia.
24160573 rs1532624 Single Nucleotide Polymorphism of CETP gene is associated with reduced response to statin therapy.
24115030 In a humanized triple transgenic mouse model with hypercholesterolemia, sPLA2-IIA inhibition increases CETP activity via increasing the very low-density lipoprotein-apoE content, resulting in a proatherogenic lipoprotein profile.
24091356 A lower cholesterol concentration in the HDL fraction in children with a family history of cardiovascular system diseases was determined by the G279A polymorphism of the CETP gene.
24080640 we showed that in carriers of the rs3764261 T variant of CETP, high-density lipoprotein increased more during statin treatment
24078569 Compared with CC or CA genotypes, individuals with AA genotype had lower CETP levels and higher high-density lipoprotein cholesterol levels.
23988150 Association between CETP gene variants and low HDL-C phenotype in Turkish children.
23977315 CETP 405V is a risk allele against longevity in Chinese.
23950155 CETP variants are associated a risk of developing PCV among the Japanese population.
23891427 genetic CETP variants were not associated with recurrent MI or recurrent revascularization in overall cohort with a possible mortality increase in patients who underwent CABG.
23772784 I405V polymorphism of CETP gene plays an important role as independent factor in the risk of endometriosis in women.
23758630 The absence the Taq1B2 allele was associated with CAD in the Chinese population only and the minor allele of the Taq1B polymorphism of the CETP gene was significantly associated with higher plasma HDL-C levels in Chinese men.
23678159 Low CETP activity is associated with an increased level of cardiovascular risk in patients with rheumatoid arthritis.
23676183 CETP inhibition increases postprandial insulin secretion in pancreatic beta-cells.
23656756 CETP SNP had a statistically significant association with HDL plasma levels.
23623643 CETP and LPL DNA methylation levels are associated with blood lipid profile in familial hypercholesterolemia.
23620138 By increasing CETP expression, FXR activation leads to a proatherogenic lipoprotein profile
23591416 Low normal thyroid function could influence atherosclerosis susceptibility in type 2 diabetes mellitus by increasing plasma cholesteryl ester transfer protein level.
23555584 Following regression analysis adjusted by collection center, gender, duration of diabetes, and average HbA1c, two SNPs were significantly associated with DN. rs4420638 in the APOC1 region and rs1532624 in CETP.
23522788 Data suggest that CETP protein is elevated above control level in plasma in HIV-associated lipodystrophy syndrome; however, CETP activity in plasma is not elevated. Thus, inhibitors of CETP activity may be present in plasma of HIV patients.
23477743 Lower plasma CETP or higher PLTP activity was each associated with a significantly increased risk of cardiovascular disease.
23389097 Single nucleotide polymorphisms of angiotensin-converting enzyme (ACE), nuclear factor kappa B (NFkB)and cholesteryl ester transport protein (CETP) were evaluated in nonagenarians, centenarians, and average life span individuals (controls).
23351584 No interactions of the apoB/apoA-I ratio and the TC/HDL-C ratio with the TaqIB and the -629C>A CETP variations on incident MACE were observed.Cholesteryl ester transfer protein (CETP)
23312786 Plasma CETP activity represents a potent indicator of cardiovascular risk in patients with metabolic disorders since it integrates major independent risk factors.
23189141 These findings support the contention that HDL functionality is maintained in heterozygous CETP deficiency despite modifications in lipid and protein composition.
23181436 this preliminary study showed that the gene variants of ABCA1R219K and LIPC-250 G/A might influence AD susceptibility in South Chinese Han population, but the polymorphism of CETPTaq1B didn't show any association
23157875 The NOS3 T allele strongly interacts with CETP B1 allele to augment the risk of coronary artery disease and type 2 diabetes mellitus in the population of Western Iran.
23129316 A meta-analysis of a Chinese population found that the CETP TaqIB gene polymorphism was suggested to be associated with coronary artery disease susceptibility.
23083790 Genetic CETP inhibition associates with reductions in risk of ischemic heart disease, myocardial infarction, ischemic cerebrovascular disease, and ischemic stroke...
23039379 Investigated whether the CETP gene I405V and Taq1B polymorphisms modified subclinical atherosclerosis in an asymptomatic Brazilian population sample. However, no associations with the V allele or CETP and PLTP activities were observed.
22952570 analysis of LIPG, CETP, and GALNT2 mutations in Caucasian families with extremely high HDL cholesterol
22928361 Results indicate that in obese men CETP gene Tag1B polymorphism may be an independent factor influencing HDL-cholesterol.
22904275 Elevated CETP activity improves plasma cholesterol efflux capacity from human macrophages in women.
22854712 The 451Q allele, associated with lower high-density lipoprotein-cholesterol (HDL-C) and higher total cholesterol and apolipoprotein B (ApoB) concentrations, was also significantly associated with an increased risk of significant stenosis
22850130 Ezetimibe may affect HDL metabolism and reverse cholesterol transport, especially CETP, in T2 diabetes mellitus.
22813404 In patients with metabolic syndrome, the Taq1B genotypes of CETP protein showed a significantly higher B1B1 genotype and lower B2B2 genotype compared to controls.
22729881 The CETP promoter -629C/A polymorphism (the -629 AA genotype) was associated with high cholesterol; high LDL-C and low CETP level, in patients with metabolic syndrome.
22679067 CETP structure and function
22623978 A strong association of CETP rs3764261 with high-density lipoprotein cholesterol.
22584245 Report role of CETP polymorphisms in determining efficacy of atorvastatin/simvastatin therapy.
22556171 in the present study, the TaqIB polymorphism of CETP was found to be associated with coronary artery disease in the Chinese population
22474067 apoC1 as a CETP inhibitor no longer operates on cholesterol redistribution in high-risk patients with dyslipidemia
22464213 Common and rare genetic variants in CETP and LIPC, but not LIPG, were more commonly found in the Thai HALP group, which could potentially contribute to high high-density lipoprotein cholesterol phenotypes in this population.
22464147 In conclusion, CETP I405V valine homozygosity was associated with better cognitive function in persons aged 65 years or older.
22414273 Cholesteryl ester transfer protein gene polymorphisms are associated with an increased risk of FLD in adolescent females.
22403620 genetic, sex-dependent CETP splicing effects on cardiovascular risk by a mechanism independent of circulating HDL-C levels
22344176 CETP bridges a ternary complex with its N-terminal beta-barrel domain penetrating into high-density lipoproteins and its C-terminal domain interacting with low-density lipoprotein or very-low-density lipoprotein.
22339301 In CETP deficient subjects, marked changes are seen in lipoprotein profile and composition. includes discussion of results in heterozygotes v. homozygotes and discussion of repercussions of CETP antagonists [review-type article]
22265126 CETP inhibition specifically improves postprandial SR-BI and ABCG1-dependent efflux to larger HDL2b subspecies.
22234866 In a case-control study of 1,089 oldest-old (ages 92-93) and 736 middle-aged Danes, the minor allele frequency (MAF) of rs769449 (APOE) was significantly decreased in the oldest-old, while the MAF of rs9923854 (CETP) was significantly enriched.
22143414 a significant interaction between CETP variants and CETP activity for affecting HDL-C levels(CETP)
22122993 There are more rare CETP gene mutations in Japanese, and these multiple rare mutations alone or a combination with each of prevalent mutations is responsible for mild-to-moderate or marked hyperalphalipoproteinemia, respectively.
22122979 is consistent with data showing that the CETP I405V is associated with increased neuritic plaque density at autopsy
22079329 Commentary: Role of CETP inhibition in treating atherosclerotic disease.
22073289 presence of the B1B1 Taq1B CETP genotype contributes to the presence of diabetes, independently of age, sex, BMI and waist. However, among carriers of B1B1, the presence of GG genotype of the -250 LIPC polymorphism increases this risk further
22056562 these data suggest a new mechanism by which apoA-I stimulates CETP secretion, in addition to apoE, from lipid loaded macrophages, a process involving NF-kappaB inhibition and/or PKA pathway activation.
21982411 CETP modulator dalcetrapib specifically increased markers of cholesterol absorption in healthy subjects.
21899732 genetic association studies in population in Greece: A polymorphism in first intron of CETP is associated with coronary artery disease (but cannot distinguish between LMCAD and MPCAD); a polymorphism in exon 14 (I405V) is not associated with CAD.
21892657 CETP may contribute to the genetic variability of brain structure and dementia susceptibility in an APOE-dependent manner.
21822774 AAV8-mediated overexpression of human LCAT in hCETP/Ldlr(+/-) mice resulted in profound changes in plasma lipid profiles.
21816162 Human CETP expression increased cellular cholesterol levels and enhanced insulin-stimulated Akt phosphorylation and glucose uptake in adipocytes.
21767357 CETP Ile405Val and APOE Cys112Arg are associated with both the prevalence of low HDL-cholesterol level and with the prevalence of abdominal obesity
21765051 Single-nucleotide polymorphisms in CETP is associated with chronic kidney disease in Type 2 diabetes.
21689002 the CETP B1 allele is associated with increased risk of CAD and T2DM independent of plasma HDL-C level in our population.
21609439 The effects of varying activities of plasma CETP on postprandial lipemia and precocious atherosclerosis in asymptomatic adult women, were investigated.
21591583 Polymorphisms of the ABCA1 and CETP genes are associated with altered plasma HDL-C concentrations.These associations on HDL-C levels are modified by BMI in a Chinese population of the Chengdu area.
21524747 cholesteryl ester transfer rather than plasma cholesteryl ester transfer protein mass may have a role in cardiovascular risk
21380728 determined the distribution of the polymorphic variants of CETP TaqIB and ApoE genes and their association with lipid and anthropometric parameters in hyperlipidemic and normolipidemic Asian Indians
21376264 Data show that unhealthy lifestyle habits and increased BMI are closely associated with high CETP activity in apparently healthy adolescent males.
21371711 CETP and LIPC polymorphisms influence the respective hepatic transcript levels, demonstrate interactions on HDL cholesterol and suggest that imbalances between CETP and LIPC activities may modulate the risk of carotid atherosclerosis
21354572 a novel deletion mutation in the CETP promoter is associated with high HDL-C and decreased promoter activity
21352420 Suggest that smaller LDL size, which is associated with higher levels of triglycerides and CETP and the hepatic lipase CC genotype, may serve as a risk factor for coronary artery disease in hemodialysis patients.
21252145 The effects of common variants in the LPL, LIPC, and CETP genes on HDL-C levels are modified by physical activity.
21185205 genetic association studies in population in India: An SNP in CETP promoter (-629C>A) is associated with patients with both cardiovascular disease and type 2 diabetes.
21146168 LPL polymorphism (D9N) predicts cardiovascular disease risk directly and through interaction with CETP polymorphism (TaqIB) in women with high HDL cholesterol and CRP.
21062971 Observational study of gene-disease association. (HuGE Navigator)
21039385 Observational study of gene-disease association. (HuGE Navigator)
20937151 CETP and PLTP activities were negatively related with the ratio of HDL-C/LDL-C.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20838585 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20835684 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20822508 genetic association studies in Iranian population: serum HDL-cholesterol level has significant association with a CETP polymorphism (an SNP detected by Taq1B RFLP assay)
20822508 Observational study of gene-disease association. (HuGE Navigator)
20799898 CETP Taq1B polymorphism neither plays a role in determining HDL-C levels nor is a useful predictor of the risk of coronary artery disease.
20799898 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20717043 Observational study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20694148 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20581105 The strong association of the CETP single nucleotide polymorphisms and HDL-C was not statistically modified by diet or by the other environmental factors.
20581105 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20578904 These results suggest that SNPs in lipid and statin pathway genes are associated with reduced LDL-C lowering by statins
20578904 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20511482 Observational study of gene-disease association. (HuGE Navigator)
20494359 Indicate that LXRalpha has an essential role in the regulation of CETP expression and maintaining reverse cholesterol transport.
20489166 Cholesteryl ester transfer protein polymorphism (TaqIB) associates with risk in postinfarction patients with high C-reactive protein and high-density lipoprotein cholesterol levels.
20489166 Observational study of gene-disease association. (HuGE Navigator)
20458649 Applied molecular tests to improve early clinical identification of patients threatened by a future course of complicated active atherosclerosis. CETPrs708272, may help to predict an active, symptomatic course atherosclerosis.
20458649 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20431066 CETP restores HDL-C levels in scavenger receptor class B type I (SR-BI) knockout mice, but it does not change the susceptibility to atherosclerosis and other typical characteristics that are associated with SR-BI disruption.
20430392 Observational study of gene-disease association. (HuGE Navigator)
20421239 Elderly group had elevated triglycerides in high-density lipoprotein with enhanced cholesteryl ester transfer activity, elevated level of advanced glycated end products in lipoproteins and fragmentation of apoA-I.
20413969 skim milk enriched with olive oil increases the HDL cholesterol and apolipoprotein A-I levels in children with hypercholesterolemia, this effect being more intense in carriers of the CETP B1B1 genotype
20413969 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20413122 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20400780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20398902 the CETP-TaqIB polymorphism does not appear to play a role in lowering coronary heart disease risk in a Mediterranean population
20398902 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20394740 the CETP promoter variant and also apoE isoforms and menopause could operate as potent modulators of HDL-c concentrations.
20394740 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20385826 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20385819 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20370913 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20228163 Physical inactivity decreases high density cholestrol, at least in part through CETP regulation.
20200605 Observational study of gene-disease association. (HuGE Navigator)
20195290 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20167577 Observational study of gene-disease association. (HuGE Navigator)
20160193 Observational study of gene-disease association. (HuGE Navigator)
20138746 contributes to the heterogeneity in high density lipoprotein cholesterol responsiveness induced by the high carbohydrate and low fat diet.
20082485 Genetic variants involved in gallstone formation such as the apolipoprotein B rs693 and CETP rs708272 polymorphisms may be related to the risk of developing GBC in Chilean women.
20082485 Observational study of gene-disease association. (HuGE Navigator)
20068209 This preliminary report suggests that CETP V405 valine homozygosity is associated with slower memory decline and lower incident dementia and AD risk.
20068209 Observational study of gene-disease association. (HuGE Navigator)
20065167 low endogenous CETP plasma levels per se are associated with increased cardiovascular and all-cause mortality, challenging the rationale of pharmacological CETP inhibition
20059631 Observational study of gene-disease association. (HuGE Navigator)
20031591 Observational study of gene-disease association. (HuGE Navigator)
20031564 Singe-nucleotide polymorphisms near or in the CETP gene at 16q13 were associated with both HDL-C and risk of incident myocardial infarction.
20031564 Observational study of gene-disease association. (HuGE Navigator)
20031551 Observational study of gene-disease association. (HuGE Navigator)
20026784 Observational study and clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20006332 Type 2 diabetes is associated with a more atherogenic lipid profile; the CETP TaqIB variant may partly prevent these modifications in diabetic women with a milder degree of insulin resistance and its related disorders.
20006332 Observational study of gene-disease association. (HuGE Navigator)
19956911 Patients with metabolic syndrome had 38% higher serum cholesteryl ester transfer protein (CETP) activity than that of the control group.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19948972 In this prospective investigation of a community-based sample, lower plasma cholesteryl ester transfer protein activity is associated with greater cardiovascular disease risk.
19926784 individual changes in HDL-C were predicted by the CETP polymorphism (CC versus AA+CC, P=0.006) in glucocorticoid users in growth hormone deficiency
19926784 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19850020 The alterations in lipoprotein profile, CETP, PON 1 and LpPLA(2) activities described in the present study indicate that non-treated iron deficiency anaemia might represent a proatherogenic state.
19822408 Compared with individuals with at least one B2 allele of CETP carriers of the B1B1 genotype showed lower HDL-cholesterol levels and higher insulin and HOMA levels
19822408 Observational study of gene-disease association. (HuGE Navigator)
19815603 results do not indicate that the TaqIB variation at the CETP gene locus is a significant predictor for assessing the risk of developing coronary restenosis following PTCA and stenting.
19815603 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19810818 the combined T allele of LIPC -514C/T and V allele of CETP I405V are associated with the risk of coronary artery disease.
19810818 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19784962 The CETP -629C > A polymorphism is not among the determinants of the coronary artery disease in Turks.
19773416 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19764573 Polymorphism of CETP TaqIB may influence the response of TC/HDL-C to HC/LF diet in males and the increases of TG/HDL-C and log (TG/HDL-C) induced by HC/LF diet in females.
19764573 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19733717 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19728844 The results suggest that patients homozygous for the B2 allele and not taking statin had a strong increase of recurrent cardiovascular event after an initial acute coronary event
19728844 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19691831 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19689828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19679263 An example of a "mapping" SNP in a candidate gene is one in the cholesterol ester transfer protein (CETP) gene (rs3764261), which is strongly associated with HDL levels (P b 2.3 x 10-57) (Willer et al. 2008).
19642912 Observational study of gene-disease association. (HuGE Navigator)
19641010 analysis of cholesteryl ester transfer protein deficiency where serum remnant-like particle-triglyceride significantly increased, but serum remnant-like particle-cholesterol did not after an oral fat load
19625176 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19564641 the CETP-induced increase of triglycerides (TG) in the HDL fraction of E3L mice is not associated with changes in the production of TG or with tissue-specific clearance of TG from the plasma.
19558660 This study assessed the gender-specific influence of the cholesteryl ester transfer protein (TaqIB, I405V) and lipoprotein lipase (S447X) polymorphisms on the response to an oral fat tolerance test in heterozygotes for familial hypercholesterolaemia.
19558660 Observational study of gene-disease association. (HuGE Navigator)
19558216 Data show that 12 SNPs from CETP, APOAI, ABCB1, CYP7A1, and HMGCR genes to be associated with baseline LDL-C and high-density lipoprotein cholesterol levels and increased risk of CAD.
19558216 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19491422 Taq 1B polymorphism of CETP gene was associated with changes in lipids profile and plasma CETP activity in the selected population and might have a role in contributing to genetic risk of developing coronary artery disease
19491422 Observational study of gene-disease association. (HuGE Navigator)
19489872 Single nucleotide polymorphisms in ESR1, CETP and LPL had significant effects on baseline plasma levels of TG-rich and HDL subpopulations.
19489872 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19471550 No significant association was found between CETP I405V polymorphism and increased risk of coronary artery disease in Azeri population.
19471550 Observational study of gene-disease association. (HuGE Navigator)
19463799 CETP is a determinant for low-density lipoprotein-cholesterol and high-density lipoprotein-cholesterol in CETP-deficient individuals in the first year of life.
19444232 The association of two cholesterol ester transfer protein (CETP) polymorphisms, D442G and TAQIB (B1-->B2), with high-density lipoprotein (HDL) levels in 932 Chinese obese individuals (BMI >or= 27) was investigated in comparison with normal controls...
19428034 The two novel mutations in the CETP and LIPC genes found in this study are likely to be the causes of low enzyme activities and elevated HDL-C levels.
19428034 Observational study of gene-disease association. (HuGE Navigator)
19424605 The 1061Aright curved arrow G (Ile405Val) polymorphism of CETP were associated (P<0.05) with the prevalence of CKD in high- or low-risk subjects.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19417222 Cholesteryl ester transfer protein is the sole major determinant of cholesteryl ester transfer in normolipidemic rabbit plasma as a result of the inability of rabbit apoCI to change HDL electronegativity.
19403283 CETP gene influences plasma lipoproteins; genetic association studies in Greek children reveal higher HDL cholesterol (CHOL) in carriers of CETP TaqIB B2 allele & lower total CHOL:HDL-CHOL ratio compared to B1/B1 individuals.
19403283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19364639 CETP gene influences dyslipidemia via complex linkage; US genetic association study reveals effects of intergenic polymorphism (rs11774572) on metabolic syndrome are mainly driven by association of C allele with lower HDL cholesterol & higher TG.
19364639 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19360375 TaqIB abd I405V polymorphisms of CETP are moderately associated with obesity risk in chinese population.
19360375 Observational study of gene-disease association. (HuGE Navigator)
19359809 None of the genetic variants exerted a greater influence on HDL levels than those at CETP.
19359809 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19345354 data indicate that the increase in VLDL-C is the most important factor contributing to the proatherogenic effect of CETP in E3L mice.
19341173 The study did not confirm associations between genetic polymorphisms of ABCA1 transporter, CETP and apoE and abnormal serum lipid profile during remission of nephrotic syndrome.
19341173 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19299407 Observational study of gene-disease association. (HuGE Navigator)
19285487 Observational study of gene-disease association. (HuGE Navigator)
19282863 Observational study of gene-disease association. (HuGE Navigator)
19282272 Data show that the model provides a plausible representation of CETP activity in vitro.
19273719 Early-life sodium exposure exacerbated hypertension and unmasked stroke susceptibility, with greater female vulnerability in hypertensive, hyperlipidemic transgenic CETP rats
19263529 Observational study of gene-disease association. (HuGE Navigator)
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19242900 CETP I405V polymorphism contributes to the unfavorable changes of apoA-I and HDL-C in a low polyunsaturated fat diet.
19242900 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19217440 Polymorphisms may increase risk of myocardial infarct.
19217440 Observational study of gene-disease association. (HuGE Navigator)
19200546 CETP deficiency does not predispose to atherosclerosis in the absence of major cardiovascular risk factors [case report]
19193611 Results indicate that CETP inhibition increases plasma concentrations of apoA-II by delaying HDL apoA-II catabolism and significantly alters the remodeling of apoA-II-containing HDL subpopulations.
19191759 The level of CETP expression can influence the responsiveness to dietary fat and may lead to fat intolerance.
19184337 Our results suggest that CETP gene polymorphisms might influence white matter lesion load and the risk of vascular dementia, the latter in non-carriers of the APOE4 allele.
19184337 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19168039 The risk in non hypertensive and male coronary heart disease patients is higher in the presence of CETP B1B1 and CA genotypes.
19168039 Observational study of gene-disease association. (HuGE Navigator)
19165812 Results indicate that I405V polymorphism of the cholesteryl ester transfer protein may affect the HDL cholesterol levels in the Turkish population.
19165812 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19155782 Observational study of gene-disease association. (HuGE Navigator)
19148283 Observational study of gene-disease association. (HuGE Navigator)
19147676 Bexarotene increased VLDL-associated TG in both E3L (+47%) and E3L.CETP (+29%) mice by increasing VLDL-TG production (+68%).
19140312 an association between apo E polymorphism and CETP activity and this association did not affect the relationship between apo E polymorphism and triglyceride and HDL cholesterol concentrations.
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19131637 study of the influence of ATP-binding cassette A1 and CETP genetic variants on lipoprotein subclasses demonstrates the importance of interpreting lipoprotein subclasses within the context of the biochemical processes
19131637 Observational study of gene-disease association. (HuGE Navigator)
19099922 Observational study of gene-disease association. (HuGE Navigator)
19086575 Taq 1B polymorphism of cholesteryl ester transfer protein gene was associated with changes in lipids profile and plasma cholesteryl ester transfer protein activity in the selected population
19086575 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19056069 Data suggests that the B2 allele is associated with higher concentrations of HDL-C, which confer a protective effect with regard to coronary atherosclerosis.
19056069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19038848 Torcetrapib differentially modulates the biological activities of HDL2 and HDL3 particles in the reverse cholesterol transport pathway.
19038839 The Int 14A variant of the CETP gene may increase odds for healthy aging.
19018779 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18957472 In statin-treated male CAD patients, genetic variation conferring low CETP levels is associated with increased 10-year mortality.
18957472 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18956684 CETP BI allele was an independent risk factor for predisposition to non-valvular atrial fibrillation.
18956684 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18926541 Report novel mutations of CETP gene in Italian subjects with hyperalphalipoproteinemia.
18851690 Mineralocorticoid and blood pressure responsiveness to dietary salt intake are not significantly related to physiological interindividual differences in plasma CETP.
18849221 CETP TaqIB polymorphism appears not to be associated with the likelihood of metabolic syndrome other than atherogenic dyslipidemia in adult Turkish population.
18849221 Observational study of gene-disease association. (HuGE Navigator)
18841571 No association was found between the L296Q polymorphism in the CETP gene and T2DM as well as plasma lipid levels in various groups of Chinese in this study.
18841571 Observational study of gene-disease association. (HuGE Navigator)
18835593 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18823627 Observational study of gene-disease association. (HuGE Navigator)
18804459 CETP may nt be strongly associated with increased HDL-cholesterol
18787507 Observational study of gene-disease association. (HuGE Navigator)
18728123 Observational study of gene-disease association. (HuGE Navigator)
18680734 CETP gene variations influence cerebral and peripheral cholesterol metabolism, but not Alzheimer's disease risk
18680734 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18669886 Niacin increases HDL by reducing hepatic expression and plasma levels of cholesteryl ester transfer protein in APOE*3Leiden.CETP mice.
18667902 The polymorphism predicted differences in HDL-C and ApoAI in the Hei Yi Zhuang but not in the Han Chinese, even after adjustment for confounding variables.
18667902 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18665040 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18637884 Unlike men, women the age- and race-adjusted odds ratio was found to be significant in 4 out of the 5 CETP single variants in a case-control study from western Washington State.
18637884 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18622260 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18562803 FXRalpha down-regulates CETP gene expression via binding to the DR4RE sequence within the CETP 5' promoter and this FXRalpha binding is essential for FXRalpha inhibition of LXRalpha-induced CETP expression.
18560005 Three CETP genotypes that are associated with moderate inhibition of CETP activity (and, therefore, modestly higher HDL-C levels) show weakly inverse associations with coronary risk.
18560005 Meta-analysis of gene-disease association. (HuGE Navigator)
18549840 The A-allele of the CEPT gene C629A SNP int the promoter region was associated with decreased cardiovascular death.
18549840 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18518852 Tha plasma concentration of HDL cholesterol is influenced by the TaqIB CETP polymorphism, but inconsistent associations of this CETP gene variant with cardiovascular disease have been reported [review]
18518852 Meta-analysis of gene-disease association. (HuGE Navigator)
18513389 Observational study of gene-disease association. (HuGE Navigator)
18509195 CETP plays a complex role in modulating ER stress, with its expression inducing the response and its cholesteryl ester transfer activity and differential splicing modulating the response in other ways.
18503096 Although CETP activity correlated with HDL-C levels, neither high CETP activity nor low HDL-C was associated with cardiovascular events in chronic kidney disease stage V patients.
18494281 genotype of gene LPL and B2 allele of gene CETP in patients elder 90 years are found significantly more frequently than in younger patients, that makes possible to consider they as markers of favorable course of disease and patients' long life.
18494281 Observational study of gene-disease association. (HuGE Navigator)
18468607 analysis of CETP variants among individuals of Asian ancestry shows a single nucleotide polymorphism and a splicing variation
18454345 CETP Taq1B polymorphism showed no association with obesity in North Indian subjects.
18454345 Observational study of gene-disease association. (HuGE Navigator)
18393253 These results suggest that CETP TaqIB (B2 allele as protective factor) genetic polymorphisms may be associated with the non-valvular atrial fibrillation in the Chinese Han population.
18393253 Observational study of gene-disease association. (HuGE Navigator)
18369235 lipoprotein composition may influence the status of lipid transfer inhibitor protein activity
18354102 Observational study of gene-disease association. (HuGE Navigator)
18289550 Observational study of gene-disease association. (HuGE Navigator)
18287799 TaqIB polymorphism is associated with plasma HDL cholesterol levels and parental history of cardiovascular disease in Taiwan.
18287799 Observational study of gene-disease association. (HuGE Navigator)
18279878 probucol decreases plasma ANGPTL3 and HDL phospholipids while increasing prebeta1-HDL and cholesteryl ester transfer protein
18275964 CETP, but not hepatic lipase or lipoprotein lipase, has a role in regulating HDL-c and LDL-c levels in menopausal women
18275964 Observational study of gene-disease association. (HuGE Navigator)
18243217 analysis of Cholesteryl ester transfer protein genetic polymorphisms, HDL cholesterol, and subclinical cardiovascular disease in the Multi-Ethnic Study of Atherosclerosis
18243217 Observational study of gene-disease association. (HuGE Navigator)
18239576 CETP plays an important role in the metabolic syndrome, possibly involving novel functions of CETP
18239576 Observational study of gene-disease association. (HuGE Navigator)
18221399 Conventional glucocorticoid replacement appears to diminish the association of HDL cholesterol with a common CETP gene variation.
18221399 Observational study of gene-disease association. (HuGE Navigator)
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187430 Observational study of gene-disease association. (HuGE Navigator)
18178167 Multiple linear regression analysis confirmed the independent association of cellular cholesterol efflux to plasma with CETP genotype
18178167 Observational study of gene-disease association. (HuGE Navigator)
18164013 simultaneous presence of CETP (Cholesteryl ester transfer protein)and LIPC (hepatic lipase) gene variants yield low CETP mass and HL activity and high plasma HDL-cholesterol ; an increased risk for coronary artery disease was found in these patients.
18164013 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18064308 Highlight a previously unknown positive relationship between CETP plasma levels and blood coagulability that might relate to risks for thrombotic events.
18063597 The association of alcohol with HDL-C levels was modified by CETP TaqIB2 carrier status, and there was also a suggestion of a gene-environment interaction on the risk of CHD.
18063597 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18056760 Report the effect of CETP overexpression and inhibition on reverse cholesterol transport.
18036514 The G allele of CETP D442G may have a potential protective effect against the development of AD, especially in APOE epsilon4 carriers, in Northern Han-Chinese, possibly through regulating the HDL level in the brain.
18036514 Observational study of gene-disease association. (HuGE Navigator)
18034366 Observational study of gene-disease association. (HuGE Navigator)
18033754 Inhibition of CETP reduced the VLDL apoE pool size (-28%) by increasing the VLDL apoE fractional catabolic rate (77%) and leaving the VLDL apoE production rate unchanged
17991755 CETP has a novel protective role in early steps of reverse cholesterol transport via its complexation with high-density lipoprotein (HDL) particles.
17991668 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17991668 interaction between the CETP TaqIB polymorphism and intake of dietary fat on plasma HDL concentration.
17970962 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17970962 TaqIB polymorphism in CETP gene results in a significant increase in the risk of early onset myocardial infarction in smokers who carry the TAQIB allele.
17949364 Observational study of gene-disease association. (HuGE Navigator)
17931083 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17855807 Observational study of gene-disease association. (HuGE Navigator)
17852818 study suggests that, despite a relationship between a common CETP gene variation and plasma cholesteryl ester transfer, the association between CETP gene and HDL cholesterol appears to be in part unexplained by plasma cholesteryl ester transfer process
17852818 Observational study of gene-disease association. (HuGE Navigator)
17848121 Observational study of gene-disease association. (HuGE Navigator)
17848121 the TaqIB polymorphism in the cholesteryl ester transfer protein gene locus may affect postprandial plasma lipoprotein levels in heterozygotes for familial hypercholesterolemia
17785925 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17767699 The VV genotype tended to be associated with lower risk of CHD mortality in women, but this difference was not statistically significant.
17709636 (Cholesteryl ester transfer protein) CETP expression restores to normal the impaired reverse cholesterol transport in mice deficient in scavenger receptor class B, type I.
17700364 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17666459 Observational study of gene-disease association. (HuGE Navigator)
17666459 the CETP TaqIB polymorphism is a good genetic predictor of cardiac mortality in type 2 diabetes.
17658505 High CETP promotes the transport of lipids among lipoproteins, which changed the lipid composition of LDL, resulting in the increase of in vivo Ox-LDL level, and subsequently contributing to the atherogenic process in dyslipidaemias subjects.
17615573 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17588582 CETP overexpression in transgenic mice does not affect reverse cholesterol transport from macrophages to feces in vivo or the protection conferred by HDL against LDL oxidative modification
17587768 there is the possibility that the CETP gene variation may affect coronary risk apart from the level of HDL-C
17587762 Observational study of gene-disease association. (HuGE Navigator)
17587762 Human cholestryl ester transfer protein polymorphism is associated with cardiovascular diseases
17568951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17568242 Observational study of gene-disease association. (HuGE Navigator)
17568242 Provides additional evidence for the association of CETP with high density lipoprotein levels and suggests that CETP is an atherogenic protein increasing the risk of myocardial infarction.
17555738 The results demonstrate that the decreased serum albumin level might be a main determinant of the increased CETP concentration in pediatric nephrotic syndrome.
17531380 Observational study of gene-disease association. (HuGE Navigator)
17531380 There were, however, no significant associations of CETP genotype with either childhood IQ or current cognitive function in old age, or with lifetime change in cognitive function.
17522050 Studies in adipocytic cells strongly support a novel role for CETP in intracellular lipid transport and storage.
17519358 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17519358 CETP and APOE genotypes account for up to 9% of the variance in HDL-c phenotypes in the HERITAGE Family Study
17512363 Observational study of gene-disease association. (HuGE Navigator)
17512363 multiple, less common SNPs and haplotype variants underlie CETP-related coronary artery disease risk; occurrence of risk-related variants on separate haplotypes suggests genetic-risk complexity and allelic heterogeneity
17512305 Observational study of gene-disease association. (HuGE Navigator)
17503098 Carriers of polymorphism of the CETP gene increases the risk of Alzheimer disease in the abscence of the apolipoprotein e-4 allels.
17495597 phospholipid and cholesteryl ester transfer proteins are important in very low and high-density lipoprotein metabolism and display concerted actions in patients with type 2 diabetes [review]
17440012 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17440012 interaction of this LIPC variant with CETP on HDL-cholesterol levels affecting risk of myocardial infarct in men
17335774 demonstrate a critical role of CETP in nicotinic acid-mediated HDL elevation
17318300 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17311515 Increased fasting CETP activity may contribute to increased risk of atherosclerosis in subjects with impaired glucose tolerance
17310124 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17310124 These findings provide evidence of a protective effect of the B2B2 genotype of the CETP Taq1B polymorphism on the likelihood of having a first event of Acute Coronary Syndromes in normal-weight persons
17293475 Bone marrow-derived CETP from CETP transgenic mice induces a proatherogenic lipoprotein profile and promotes the development of atherosclerotic lesions in LDL receptor knockout mice.
17287950 Observational study of gene-disease association. (HuGE Navigator)
17287950 Multivariate analysis showed the common AAB2 haplotype defined by the G-2708A, C-629A and TaqIB polymorphisms, was consistently associated with reduced CETP activity and increased HDL-C levels
17275808 Observational study of gene-disease association. (HuGE Navigator)
17275808 CETP gene may play an important role in determining coronary artery disease in Corsican population
17272756 Role for CETP in remodeling HDL and providing an alternative pathway for the selective uptake of HDL cholesteryl ester by the liver.
17196207 CT heterozygotes ( cholesteryl ester transfer protein variants C>T/In9 ) gained more weight with overfeeding and had higher fat mass (FM) than the CC homozygotes
17190939 Observational study of gene-disease association. (HuGE Navigator)
17160943 Observational study of gene-disease association. (HuGE Navigator)
17157861 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17157861 plasma HDL-Cholesterol levels differ according to Cholesterol Ester Transfer protein (CETP) genotypes and was not affected by dietary fat intake
17108362 the role of natural variations in modulating CETP and high density lipoprotein-cholesterol (HDL-C) levels
17097007 The Taq1B CETP gene polymorphism should be a strong determinant of HDL-C in hyperlipidemia patients, and might contribute to the heterogeneity in HDL-C response to dietary intervention.
17097007 Observational study of gene-disease association. (HuGE Navigator)
17055779 Recombinant CETP expression in mouse increases direct removal of HDL CE in the liver and this process is independent of SR-BI, LRP, and possibly LDLR.
16986521 CETP-TaqIB gene polymorphism influenced serum HDL level, but this gene polymorphism at CETP locus wasn't especial in adult obesity.
16986521 Observational study of gene-disease association. (HuGE Navigator)
16946130 CETP expression in APOE*3-Leiden (E3L) mice shifts the distribution of cholesterol from HDL to VLDL/LDL, reduces plasma-mediated SR-BI-dependent cholesterol efflux, and represents a clear pro-atherogenic factor in E3L mice.
16890925 Observational study of gene-disease association. (HuGE Navigator)
16855190 CETP mass was higher in men with metabolic syndrome but not in women.
16837242 Observational study of gene-disease association. (HuGE Navigator)
16829344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16822236 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16797310 Observational study of gene-disease association. (HuGE Navigator)
16797310 CETP genotypes have effects on the serum lipid profile among renal transplant patients.
16770077 Observational study of gene-disease association. (HuGE Navigator)
16763159 Observational study of gene-disease association. (HuGE Navigator)
16684835 Observational study of gene-disease association. (HuGE Navigator)
16674961 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16623947 Observational study of gene-disease association. (HuGE Navigator)
16623947 An association between the CETP TaqIB polymorphism and atrial fibrillation.
16563399 Role of CETP in modulating HDL-C and cardiovascular disease.
16553359 Observational study of gene-disease association. (HuGE Navigator)
16553359 I405V polymorphism may have potential importance in screening individuals at high risk for developing coronary stenosis.
16544732 Observational study of gene-disease association. (HuGE Navigator)
16542392 Observational study of gene-disease association. (HuGE Navigator)
16522905 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16430904 Observational study of gene-disease association. (HuGE Navigator)
16430904 the rare allele of the cholesterol ester transfer protein (CETP) TaqIB variant was associated with lower ICA IMT in men.
16426594 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16426594 Results showed a gene-gene interaction between the CETP and the ApoE loci in determining HDL-C concentrations.
16420563 Observational study of gene-disease association. (HuGE Navigator)
16384616 Observational study of gene-disease association. (HuGE Navigator)
16384616 the V/V genotype of the I405V CETP polymorphism is more frequent among very old people than young ones, and is associated with a lower incidence of vascular damage
16343038 Observational study of gene-disease association. (HuGE Navigator)
16332659 Observational study of gene-environment interaction. (HuGE Navigator)
16306375 a rationale to evaluate the effects of CETP inhibitor treatment on plasma cholesterol ester transfer and on cardiovascular risk in diabetes-associated hypertriglyceridemia.
16306202 Observational study of gene-disease association. (HuGE Navigator)
16306202 Genetic variations at the CETP gene locus may account for a significant proportion of HDLC variation in Vietnamese children.
16248996 Observational study of gene-disease association. (HuGE Navigator)
16205020 Observational study of gene-disease association. (HuGE Navigator)
16159884 The molecular mechanism of the apoCI-mediated blockade of CETP activity is reported.
16141008 Observational study of gene-disease association. (HuGE Navigator)
16123327 CETP mediates selective uptake of HDL-cholesteryl ester by hepatocytes
16098387 Observational study of gene-disease association. (HuGE Navigator)
16096813 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16096813 This study suggest that CETP behaves as a modifier gene of the AD risk associated with the APOE epsilon4 allele, possibly through modulation of brain cholesterol metabolism
16086925 Observational study of gene-disease association. (HuGE Navigator)
16049032 Functional interaction between -629C/A, -971G/A and -1337C/T polymorphisms in the CETP gene is a major determinant of promoter activity and plasma CETP concentration.
16039291 Observational study of gene-disease association. (HuGE Navigator)
16039291 CETP Taq1B showed significant association with changes in plasma lipid and lipoproteins for patients in cardiac rehabilitation
16038892 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16005462 Observational study of gene-disease association. (HuGE Navigator)
16002074 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16002074 CETP has independent effects on lipid changes following fluvastatin treatment.
15996208 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15992403 Observational study of gene-disease association. (HuGE Navigator)
15979432 Observational study of gene-disease association. (HuGE Navigator)
15955471 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15952120 The CETP-TaqIB genotype is independently associated with insulin resistance and lipid metabolism. It may be an important risk factor of insulin resistance in type 2 diabetes.
15952120 Observational study of gene-disease association. (HuGE Navigator)
15939053 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15939053 Role of CETP in modulating HDL-C and cardiovascular disease.
15896905 Observational study of gene-disease association. (HuGE Navigator)
15888337 Observational study of gene-disease association. (HuGE Navigator)
15882786 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15882786 Significant association between CETP genotypes or haplotypes and late onset AD was not detected in these two study cohorts.
15864114 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15859394 Observational study of gene-disease association. (HuGE Navigator)
15856070 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15856070 The CETP polymorphism is a significant predictor of future cardiovascular disease events in statin-treated patients with familial hypercholesterolemia
15840744 Observational study of gene-disease association. (HuGE Navigator)
15811250 Cholestery ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis.
15766738 Observational study of gene-disease association. (HuGE Navigator)
15766738 Our data are in favour of an association between CETP and developing coronary artery disease (CAD), as well as the extent of CAD.
15696473 The allelic frequencies of B2 and B1 allele of CETP was 41.0% and 59.0% and the genetic polymorphisms of ABCA1 in Chinese Han ethnic population are significantly different from Caucasians residing in USA or Europe.
15696473 Observational study of genotype prevalence. (HuGE Navigator)
15655129 Meta-analysis of gene-disease association. (HuGE Navigator)
15608561 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15589073 Observational study of gene-disease association. (HuGE Navigator)
15589073 A significant sex specific effect of the TaqIB CETP polymorphism on insulin resistance parameters HDL-cholesterol and sdLDL is found in an Austrian population based study.
15585206 Observational study of gene-disease association. (HuGE Navigator)
15585206 Among these genetic polymorphisms, TaqIB of CETP and MspI of apolipoprotein AI appeared to help significantly to identify diabetic individuals. In particular, the former may have an additional role in the primary prevention of coronary disease.
15450208 Data describe a variable length tandem repeat in the cholesteryl ester transfer protein promoter that is highly polymorphic with respect to both length and sequence; the short allele of this repeat is associated with high HDL cholesterol levels in vivo.
15382463 Observational study of gene-disease association. (HuGE Navigator)
15377415 Observational study of gene-disease association. (HuGE Navigator)
15339254 overexpression of apoCI does not represent a suitable method for decreasing total CE transfer activity in CETPTg/apoCITg mice, owing to an hyperlipidaemia-mediated effect on CETP gene expression
15256516 Observational study of gene-disease association. (HuGE Navigator)
15228446 CETP localizes B cells in germinal centres, a proportion of post-germinal centre B cells and their neoplastic counterparts.
15138631 Observational study of gene-disease association. (HuGE Navigator)
15138631 Cholesteryl ester transfer protein, plasma (CETP) Taq1B gene polymorphism is an association with low HDL cholesterol levels in patients with type II diabetes mellitus and healthy controls.
15102891 Postprandial chylomicrons may play an important role in promoting reverse cholesterol transport in vivo by serving as the preferred ultimate vehicle for transporting cholesterol released from cell membranes to the liver via LCAT and CETP.
15099350 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15098490 Observational study of gene-disease association. (HuGE Navigator)
15085362 Observational study of gene-disease association. (HuGE Navigator)
15076187 Observational study of gene-disease association. (HuGE Navigator)
15053158 Observational study of gene-disease association. (HuGE Navigator)
15039125 Observational study of gene-disease association. (HuGE Navigator)
15036597 Observational study of gene-disease association. (HuGE Navigator)
15036597 No statistically significant differences have emerged with respect to either genotype or allele frequencies between late onset Alzheimer's disease and control populations when examining CETP TaqI B polymorphism.
14998629 Clinical trial of gene-disease association. (HuGE Navigator)
14967821 Observational study of gene-disease association. (HuGE Navigator)
14967821 Men with a CETP mutation had the lowest rates of coronary heart disease; whether a CETP mutation offers additional protection against CHD warrants further investigation.
14732872 Observational study of gene-disease association. (HuGE Navigator)
14687732 Observational study of gene-disease association. (HuGE Navigator)
14687732 CETP genotype did not influence lipid and lipoprotein levels in pregnant women.
14679166 induction of CETP constitutes a major determinant of the effect of LXR agonists on cholesterol transport and excretion
14669156 Observational study of gene-disease association. (HuGE Navigator)
14660992 Observational study of gene-disease association. (HuGE Navigator)
14583798 Observational study of gene-disease association. (HuGE Navigator)
14563342 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14559957 Observational study of gene-disease association. (HuGE Navigator)
14559957 Association of exceptional longevity with homozygosity for the valine 405 allele of CETP may explain in part the link between lipoprotein particle size and exceptional longevity
14531818 The TT genotype of HL mutation may serve as a protective factor against vascular disease by increasing HDL cholesterol levels in hemodialysis patients with higher CETP levels.
12951364 negative charge of LDL surface lipids, but not protein, is an important regulator of CETP and LTIP activity
12919138 Observational study of gene-disease association. (HuGE Navigator)
12907677 CETP is modified by LTIP and has a role in remodeling of HDL3 and HDL2 particles in subclass-specific ways, strongly implicating it as a regulator of HDL metabolism
12871320 data collected in a cohort of 779 patients of whom 342 had developed restenosis indicate that the common variants for CETP and PON are not associated with incidence of restenosis after PTCA
12840632 Observational study of gene-environment interaction. (HuGE Navigator)
12820950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12818414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12818414 CETP polymorphism were associated with moderately increased LDL peak aprticle size.
12818401 Genetic variation in the CETP gene is associated with protective HDL-cholestrol levels.
12798569 Observational study of gene-disease association. (HuGE Navigator)
12798569 In patients with CAD, the CETP/-629A allele had a strong protective effect on future mortality from cardiovascular causes, independent of its role on HDL cholesterol and CETP activity levels.
12791674 The expression of human CETP in db/db mice prevented the formation of diet-induced lesions, suggesting an antiatherogenic effect of CETP in the context of diabetic obesity.
12773093 Observational study of gene-disease association. (HuGE Navigator)
12771549 the association between high (HDL) and low-density (LDL) cholesterol concentrations and family-derived haplotypes based on six common SNPs in the cholesteryl-ester transfer protein (CETP) gene
12771320 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12771320 In I405V CETP polymorphism, percentage reductions in plasma total cholesterol with consumption of plant sterol ester were not significant. CETP concentration diminished only in the II phenotype.
12730302 Sp1 and Sp3 regulate human CETP promoter activity through three Sp1/Sp3 binding sites in a distinct manner
12700892 Observational study of gene-disease association. (HuGE Navigator)
12669678 Observational study of gene-disease association. (HuGE Navigator)
12669678 CEPT gene locus have an additional and interactive influence on plasma lipid and lipoprotein levels in children.
12663600 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12639975 Meta-analysis of gene-disease association. (HuGE Navigator)
12601526 Observational study of gene-disease association. (HuGE Navigator)
12588754 Reviewed studies reveal that human subjects with heterozygous CETP deficiency and an HDL cholesterol level >60 mg/dL have a reduced risk of coronary heart disease.
12579494 Observational study of gene-disease association. (HuGE Navigator)
12579494 IVS14A and 451Q mutants of cholesteryl ester transfer protein (CETP) gene were rare in Chinese population and 442G mutant gene was possibly one of the susceptibility factors to Coronary Arteriosclerosis in Chinese.
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12519369 Observational study of gene-disease association. (HuGE Navigator)
12519368 Observational study of gene-disease association. (HuGE Navigator)
12518020 attenuates atherosclerosis in ovariectomized mice [Cholesteryl ester transfer protein ]
12514935 Observational study of gene-disease association. (HuGE Navigator)
12499392 Observational study of gene-disease association. (HuGE Navigator)
12482565 Observational study of gene-disease association. (HuGE Navigator)
12446192 Observational study of gene-disease association. (HuGE Navigator)
12409629 Observational study of gene-disease association. (HuGE Navigator)
12401886 elevated PLTP activity in human cholesteryl ester transfer protein (huCEPT) transgenic mice results in an increase in VLDL secretion
12174215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12164095 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12164095 D442G mutation is common in Korean postmenopausal women and it is associated with increased plasma HDL cholesterol level.
12117730 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12117730 In men with coronary heart disease (CHD) and high density lipoprotein cholesterol (HDL-C)deficiency, the CETP TaqI B2B2 genotype is significantly reduced and is associated with higher levels of plasma HDL-C and lower CHD risk.
12116231 Observational study of gene-disease association. (HuGE Navigator)
12104085 Observational study of gene-disease association. (HuGE Navigator)
12104085 CETP gene mutation (D442G) increases low-density lipoprotein particle size in patients with coronary heart disease.
12091484 Observational study of gene-disease association. (HuGE Navigator)
12091484 Two novel missense mutations in the CETP gene in Japanese hyperalphalipoproteinemic subjects: high-throughput assay by Invader assay.
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12070157 present observations provide direct support for a potent specific inhibition of CETP by plasma apoCI in vivo
12055319 CETP is increased and associated with the atherogenic lipoprotein profile in obese children
12048136 Observational study of gene-disease association. (HuGE Navigator)
12048136 B2 allele of the TaqIB polymorphism is less frequent in African Americans compared with Caucasians;this polymorphism is unlikely to contribute to higher levels of HDL-C reported in African Americans.
12037734 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12037734 CETP genotype may contribute to the interindividual differences in plasma HDL-C subfraction changes occurring with endurance exercise training in sedentary middle- to older-aged men and women
12033532 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11996962 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11996962 Association between HDL-cholesterol and the Taq1B polymorphism in the cholesterol ester transfer protein gene in obese women.
11956670 Observational study of genotype prevalence. (HuGE Navigator)
11952809 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11915346 role in the regulation of the vascular cell functions
11903340 Observational study of gene-disease association. (HuGE Navigator)
11903340 TaqIB2 allele was found not to be associated with significant changes in coronary artery disease risk
11888533 Observational study of gene-disease association. (HuGE Navigator)
11888509 Observational study of gene-disease association. (HuGE Navigator)
11887180 Observational study of genotype prevalence. (HuGE Navigator)
11887180 A novel mutation in the intron 1 splice donor site of the cholesterol ester transfer protein (CETP) gene as a cause of hyperalphalipoproteinemia.
11882335 The activity and mass of cholesteryl ester transfer protein (CETP) in cord blood were higher than those in adult blood.
11872695 Observational study of gene-disease association. (HuGE Navigator)
11810297 Observational study of gene-disease association. (HuGE Navigator)
11810297 genetic variation at the CETP gene locus may account for a significant proportion of the difference in HDL-C levels
11804197 Observational study of gene-disease association. (HuGE Navigator)
11730826 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11714857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11689220 Observational study of gene-disease association. (HuGE Navigator)
11575217 Observational study of gene-disease association. (HuGE Navigator)
11533368 Observational study of gene-disease association. (HuGE Navigator)
11454014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11398140 Observational study of gene-disease association. (HuGE Navigator)
11369008 Observational study of gene-disease association. (HuGE Navigator)
11359462 Observational study of gene-disease association. (HuGE Navigator)
11341749 Observational study of genotype prevalence. (HuGE Navigator)
11322655 Observational study of gene-disease association. (HuGE Navigator)
11284423 Observational study of gene-disease association. (HuGE Navigator)
11096142 Observational study of gene-disease association. (HuGE Navigator)
11056092 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLAATVLTLALLGNAHACSKGTSHEAGIVCRITKPALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLG      1 - 70
QVKYGLHNIQISHLSIASSQVELVEAKSIDVSIQNVSVVFKGTLKYGYTTAWWLGIDQSIDFEIDSAIDL     71 - 140
QINTQLTCDSGRVRTDAPDCYLSFHKLLLHLQGEREPGWIKQLFTNFISFTLKLVLKGQICKEINVISNI    141 - 210
MADFVQTRAASILSDGDIGVDISLTGDPVITASYLESHHKGHFIYKNVSEDLPLPTFSPTLLGDSRMLYF    211 - 280
WFSERVFHSLAKVAFQDGRLMLSLMGDEFKAVLETWGFNTNQEIFQEVVGGFPSQAQVTVHCLKMPKISC    281 - 350
QNKGVVVNSSVMVKFLFPRPDQQHSVAYTFEEDIVTTVQASYSKKKLFLSLLDFQITPKTVSNLTESSSE    351 - 420
SVQSFLQSMITAVGIPEVMSRLEVVFTALMNSKGVSLFDIINPEIITRDGFLLLQMDFGFPEHLLVDFLQ    421 - 490
SLS                                                                       491 - 493
//

Text Mined References (573)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26829743 2016 [Association of CETP gene I405V/D442G polymorphisms with cerebral hemorrhage and serum lipid profile in ethnic Han population from Changsha].
26758205 2016 Cholesteryl Ester Transfer Protein (CETP) expression does not affect glucose homeostasis and insulin secretion: studies in human CETP transgenic mice.
26694435 2015 Association between Eight Functional Polymorphisms and Haplotypes in the Cholesterol Ester Transfer Protein (CETP) Gene and Dyslipidemia in National Minority Adults in the Far West Region of China.
26683795 2016 Resequencing of the CETP gene in American whites and African blacks: Association of rare and common variants with HDL-cholesterol levels.
26642708 2015 The Relationship Between Lipoprotein-Associated Phospholipase A(2), Cholesteryl Ester Transfer Protein and Lipid Profile and Risk of Atherosclerosis in Women with Iron Deficiency Anaemia.
26503844 2015 CETP/LPL/LIPC gene polymorphisms and susceptibility to age-related macular degeneration.
26370976 2015 Polymorphisms in the LPL and CETP Genes and Haplotype in the ESR1 Gene Are Associated with Metabolic Syndrome in Women from Southwestern Mexico.
26318399 2015 Association between CETP gene polymorphism, insulin resistance and risk of diabetes mellitus in patients with vascular disease.
26313355 2015 CETP Expression Protects Female Mice from Obesity-Induced Decline in Exercise Capacity.
26261636 2015 Associations of common SNPs in the SORT1, GCKR, LPL, APOA1, CETP, LDLR, APOE genes with lipid trait levels in an Algerian population sample.
26253899 2015 Genetic markers of cholesterol transport and gray matter diffusion: a preliminary study of the CETP I405V polymorphism.
26244602 2015 Cholesterol ester transfer protein polymorphism rs5882 is associated with triglyceride-lowering in response to plant sterol consumption.
26203075 2015 Defective triglyceride biosynthesis in CETP-deficient SW872 cells.
26101956 2015 Polymorphisms in LPL, CETP, and HL protect HIV-infected patients from atherogenic dyslipidemia in an allele-dose-dependent manner.
26061659 2015 Regulation of cholesteryl ester transfer protein expression by upstream polymorphisms: reduced expression associated with rs247616.
26014924 2015 Studies of the CETP TaqIB and ApoE Polymorphisms in Southern Thai Subjects with the Metabolic Syndrome.
25737239 2015 HDL surface lipids mediate CETP binding as revealed by electron microscopy and molecular dynamics simulation.
25725138 2015 TaqIB and severity of coronary artery disease in the Turkish population: a pilot study.
25696989 2014 [Polymorphism of the CETP gene promoter region and its influence on protein activity in coronary heart disease].
25606668 2015 Do genes modify the association of selenium and lipid levels?
25593327 2015 Overexpression of full-length cholesteryl ester transfer protein in SW872 cells reduces lipid accumulation.
25579610 2015 The lipoprotein lipase S447X and cholesteryl ester transfer protein rs5882 polymorphisms and their relationship with lipid profile in human serum of obese individuals.
25561046 2015 Circulating cholesteryl ester transfer protein and coronary heart disease: mendelian randomization meta-analysis.
25548261 2015 CETP genotype and changes in lipid levels in response to weight-loss diet intervention in the POUNDS LOST and DIRECT randomized trials.
25547030 2014 Effect of CETP polymorphism on atorvastatin lipid-regulating effect and clinical prognosis of patients with coronary heart disease.
25474428 2014 Meta-analysis of cholesteryl ester transfer protein TaqIB polymorphism and risk of myocardial infarction.
25463120 2014 Elevated CETP activity during acute phase of myocardial infarction is independently associated with endothelial dysfunction and adverse clinical outcome.
25449063 2014 Cholesteryl ester diffusion, location and self-association constraints determine CETP activity with discoidal HDL: excimer probe study.
25424006 2015 Atomistic MD simulation reveals the mechanism by which CETP penetrates into HDL enabling lipid transfer from HDL to CETP.
25366166 2014 Association of cholesteryl ester transfer protein (CETP) gene polymorphism, high density lipoprotein cholesterol and risk of coronary artery disease: a meta-analysis using a Mendelian randomization approach.
25341944 2014 Defective functionality of HDL particles in familial apoA-I deficiency: relevance of alterations in HDL lipidome and proteome.
25288221 2014 CETP TaqIB genotype modifies the association between alcohol and coronary heart disease: the INTERGENE case-control study.
25260850 2015 Population-based analysis of cholesteryl ester transfer protein identifies association between I405V and cognitive decline: the Cache County Study.
25201589 2014 Prediction of the influences of missense mutations on cholesteryl ester transfer protein structure.
25134189 Identification of genes contributing to cardiovascular disease in overweight and obese individuals from West Virginia.
25115339 2014 Study to assess whether waist circumference and changes in serum glucose and lipid profile are independent variables for the CETP gene.
25110219 Increased risk of premature coronary artery disease in Egyptians with ABCA1 (R219K), CETP (TaqIB), and LCAT (4886C/T) genes polymorphism.
25105518 2014 Relationships between CETP genetic polymorphisms and Alzheimer's disease risk: a meta-analysis.
25073458 2014 CETP gene polymorphism in the caucasian population of West Siberia and in groups contrast by total serum cholesterol levels.
24997672 2014 Serum cholesterol and variant in cholesterol-related gene CETP predict white matter microstructure.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24746832 2014 Fibrates and fish oil, but not corn oil, up-regulate the expression of the cholesteryl ester transfer protein (CETP) gene.
24746514 2014 Gene-gene interaction between CETP and APOE polymorphisms confers higher risk for hypertriglyceridemia in oldest-old Chinese women.
24737438 2014 Relationship between the cholesterol ester transfer protein TaqIB polymorphism and the lipid-lowering effect of atorvastatin in patients with coronary atherosclerotic heart disease.
24659026 2015 Elevated cholesteryl ester transfer protein (CETP) activity, a major determinant of the atherogenic dyslipidemia, and atherosclerotic cardiovascular disease in South Asians.
24634116 2014 Relationship of polymorphisms in the cholesteryl ester transport protein gene R451Q with coronary heart disease and diabetes in Uyghur and Han Chinese.
24615107 2014 Relationship between the TaqI B polymorphism of the cholesterol ester transfer protein gene and atrial fibrillation in Han and Kazak populations.
24574346 2014 Glycation of apolipoprotein C1 impairs its CETP inhibitory property: pathophysiological relevance in patients with type 1 and type 2 diabetes.
24533069 2014 Seven functional polymorphisms in the CETP gene and myocardial infarction risk: a meta-analysis and meta-regression.
24530617 2014 Key structural arrangements at the C-terminus domain of CETP suggest a potential mechanism for lipid-transfer activity.
24498989 2015 CETP Gene may be Associated with Advanced Age-Related Macular Degeneration in the Chinese Population.
24468472 2014 Association between the CETP polymorphisms and the risk of Alzheimer's disease, carotid atherosclerosis, longevity, and the efficacy of statin therapy.
24402318 2015 Common variants of apolipoprotein E and cholesteryl ester transport protein genes in male patients with coronary heart disease and variable body mass index.
24393849 2014 Genetic variants affecting alternative splicing of human cholesteryl ester transfer protein.
24393350 2014 Genes in the high-density lipoprotein metabolic pathway in age-related macular degeneration and polypoidal choroidal vasculopathy.
24388961 2014 A potential screening factor for accumulation of cholesteyl ester transfer protein deficiency in East Asia: Schistosoma japonicum.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24376512 2013 Gene-gene combination effect and interactions among ABCA1, APOA1, SR-B1, and CETP polymorphisms for serum high-density lipoprotein-cholesterol in the Japanese population.
24293641 2014 Cholesteryl ester transfer proteins from different species do not have equivalent activities.
24283500 2013 CETP gene polymorphisms and risk of coronary atherosclerosis in a Chinese population.
24242673 2014 Association study of promoter polymorphisms in the CETP gene with longevity in the Han Chinese population.
24204732 2013 Cholesteryl ester transfer protein inhibitors in the treatment of dyslipidemia: a systematic review and meta-analysis.
24160573 2013 Cholesteryl ester transfer protein rs1532624 gene polymorphism is associated with reduced response to statin therapy.
24115030 2013 Expression of type IIA secretory phospholipase A2 inhibits cholesteryl ester transfer protein activity in transgenic mice.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24091356 2013 Cholesterol ester transfer protein (CETP) gene polymorphism and selected parameters of lipid metabolism in children from families with history of cardiovascular system diseases.
24080640 2014 Cholesteryl ester transfer protein polymorphisms, statin use, and their impact on cholesterol levels and cardiovascular events.
24078569 2013 [Influence of CETP gene -629C/A polymorphism on the efficacy of atorvastatin treatment and clinical outcome].
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
24023260 2013 Genetic association with lipids in Filipinos: waist circumference modifies an APOA5 effect on triglyceride levels.
23988150 2013 Multi-locus candidate gene analyses of lipid levels in a pediatric Turkish cohort: lessons learned on LPL, CETP, LIPC, ABCA1, and SHBG.
23977315 2013 Trans-ethnical shift of the risk genotype in the CETP I405V with longevity: a Chinese case-control study and meta-analysis.
23950155 2013 Association between the cholesteryl ester transfer protein gene and polypoidal choroidal vasculopathy.
23891427 2013 Single nucleotide polymorphisms in cholesteryl ester transfer protein gene and recurrent coronary heart disease or mortality in patients with established atherosclerosis.
23772784 2013 I405V polymorphism of CETP gene and lipid profile in women with endometriosis.
23758630 2013 Association of CETP Taq1B and -629C?>?A polymorphisms with coronary artery disease and lipid levels in the multi-ethnic Singaporean population.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23678159 2013 Cholesteryl ester transfer protein in patients with rheumatoid arthritis.
23676183 2013 Effects of high-density lipoprotein elevation with cholesteryl ester transfer protein inhibition on insulin secretion.
23656756 2013 Single nucleotide polymorphisms in CETP, SLC46A1, SLC19A1, CD36, BCMO1, APOA5, and ABCA1 are significant predictors of plasma HDL in healthy adults.
23623643 2013 DNA methylation variations at CETP and LPL gene promoter loci: new molecular biomarkers associated with blood lipid profile variability.
23620138 2013 Farnesoid X receptor activation increases cholesteryl ester transfer protein expression in humans and transgenic mice.
23591416 2013 Low normal thyroid function enhances plasma cholesteryl ester transfer in Type 2 diabetes mellitus.
23555584 2013 Association analysis of dyslipidemia-related genes in diabetic nephropathy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23522788 2013 Altered relationship of plasma triglycerides to HDL cholesterol in patients with HIV/HAART-associated dyslipidemia: further evidence for a unique form of metabolic syndrome in HIV patients.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23477743 2013 Plasma lipid transfer proteins and cardiovascular disease. The Framingham Heart Study.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23389097 2014 The frequency of 4 common gene polymorphisms in nonagenarians, centenarians, and average life span individuals.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23351584 Common variation in cholesteryl ester transfer protein: relationship of first major adverse cardiovascular events with the apolipoprotein B/apolipoprotein A-I ratio and the total cholesterol/high-density lipoprotein cholesterol ratio.
23312786 2013 Endogenous CETP activity as a predictor of cardiovascular risk: determination of the optimal range.
23189141 2012 High-density lipoprotein (HDL) particle subpopulations in heterozygous cholesteryl ester transfer protein (CETP) deficiency: maintenance of antioxidative activity.
23181436 2012 Association studies of several cholesterol-related genes (ABCA1, CETP and LIPC) with serum lipids and risk of Alzheimer's disease.
23157875 2012 Strong interaction between T allele of endothelial nitric oxide synthase with B1 allele of cholesteryl ester transfer protein TaqIB highly elevates the risk of coronary artery disease and type 2 diabetes mellitus.
23129316 2013 Apo A5 -1131T/C, FgB -455G/A, -148C/T, and CETP TaqIB gene polymorphisms and coronary artery disease in the Chinese population: a meta-analysis of 15,055 subjects.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
23083790 2012 Genetic inhibition of CETP, ischemic vascular disease and mortality, and possible adverse effects.
23039379 2012 The I405V and Taq1B polymorphisms of the CETP gene differentially affect sub-clinical carotid atherosclerosis.
22952570 2012 Segregation of LIPG, CETP, and GALNT2 mutations in Caucasian families with extremely high HDL cholesterol.
22928361 2012 [CETP gene TaqIB polymorphism and plasma lipids in patients with overweight and obesity].
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22904275 2012 Elevated CETP activity improves plasma cholesterol efflux capacity from human macrophages in women.
22854712 2012 Four polymorphisms of cholesteryl ester transfer protein gene and coronary stenosis in a Tunisian population.
22850130 2012 Ezetimibe, an inhibitor of Niemann-Pick C1-like 1 protein, decreases cholesteryl ester transfer protein in type 2 diabetes mellitus.
22813404 Taq1B polymorphism of cholesteryl ester transfer protein (CETP) in Egyptian patients with metabolic syndrome.
22729881 2012 Cholesteryl ester transfer protein (CETP) -629C/A polymorphism and it's effects on the serum lipid levels in metabolic syndrome patients.
22679067 2012 New molecular insights into CETP structure and function: a review.
22623978 2012 A replication study of GWAS-derived lipid genes in Asian Indians: the chromosomal region 11q23.3 harbors loci contributing to triglycerides.
22584245 2013 Cholesteryl ester transfer protein and ATP-binding cassette transporter A1 genotype alter the atorvastatin and simvastatin efficacy: time for genotype-guided therapy?
22556171 2012 Association between TaqIB polymorphism of cholesteryl ester transfer protein and coronary artery disease in the Chinese population.
22474067 2012 Constitutive inhibition of plasma CETP by apolipoprotein C1 is blunted in dyslipidemic patients with coronary artery disease.
22464213 2012 Resequencing CETP, LIPC and LIPG genes in Thai subjects with hyperalphalipoproteinemia.
22464147 2012 Cholesteryl Ester Transfer Protein (CETP) genotype and cognitive function in persons aged 35 years or older.
22414273 2012 Cholesteryl ester transfer protein gene polymorphisms increase the risk of fatty liver in females independent of adiposity.
22403620 2012 Cholesteryl Ester Transfer Protein (CETP) polymorphisms affect mRNA splicing, HDL levels, and sex-dependent cardiovascular risk.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22344176 2012 Structural basis of transfer between lipoproteins by cholesteryl ester transfer protein.
22339301 2012 Lipid and apoprotein composition of HDL in partial or complete CETP deficiency.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22265126 2012 Functionality of postprandial larger HDL2 particles is enhanced following CETP inhibition therapy.
22234866 2013 Evidence from case-control and longitudinal studies supports associations of genetic variation in APOE, CETP, and IL6 with human longevity.
22143414 2012 Genetic variation in cholesterol ester transfer protein, serum CETP activity, and coronary artery disease risk in Asian Indian diabetic cohort.
22122993 2012 Novel mutations of cholesteryl ester transfer protein (CETP) gene in Japanese hyperalphalipoproteinemic subjects.
22122979 2012 The CETP I405V polymorphism is associated with an increased risk of Alzheimer's disease.
22079329 2012 CETP inhibition in perspective.
22073289 2011 Interaction between cholesteryl ester transfer protein and hepatic lipase encoding genes and the risk of type 2 diabetes: results from the Telde study.
22056562 2011 Apolipoprotein A-I stimulates cholesteryl ester transfer protein and apolipoprotein E secretion from lipid-loaded macrophages; the role of NF-?B and PKA signaling pathways.
22003152 2012 Eight genetic loci associated with variation in lipoprotein-associated phospholipase A2 mass and activity and coronary heart disease: meta-analysis of genome-wide association studies from five community-based studies.
21982411 2011 Effect of dalcetrapib, a CETP modulator, on non-cholesterol sterol markers of cholesterol homeostasis in healthy subjects.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21899732 2011 The role of common variants of the cholesteryl ester transfer protein gene in left main coronary artery disease.
21892657 2012 CETP polymorphisms associate with brain structure, atrophy rate, and Alzheimer's disease risk in an APOE-dependent manner.
21822774 2011 AAV8-mediated long-term expression of human LCAT significantly improves lipid profiles in hCETP;Ldlr(+/-) mice.
21816162 2011 Human cholesteryl ester transfer protein enhances insulin-mediated glucose uptake in adipocytes.
21767357 2011 Genetic variants in lipid metabolism are independently associated with multiple features of the metabolic syndrome.
21765051 2012 Predictive role of multilocus genetic polymorphisms in cardiovascular disease and inflammation-related genes on chronic kidney disease in Type 2 diabetes--an 8-year prospective cohort analysis of 1163 patients.
21689002 2011 Association between cholesteryl ester transfer protein TaqIB variants and risk of coronary artery disease and diabetes mellitus in the population of western Iran.
21665990 2011 Common variants near FRK/COL10A1 and VEGFA are associated with advanced age-related macular degeneration.
21609439 2011 A reduction of CETP activity, not an increase, is associated with modestly impaired postprandial lipemia and increased HDL-cholesterol in adult asymptomatic women.
21591583 2011 Differential effect of ATP binding cassette transporter A1 R219K and cholesteryl ester transfer protein TaqIB genotypes on HDL-C levels in overweight/obese and non-obese Chinese subjects.
21524747 2011 High plasma cholesteryl ester transfer but not CETP mass predicts incident cardiovascular disease: a nested case-control study.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21380728 2011 Cholesterol ester transfer protein and apolipoprotein E gene polymorphisms in hyperlipidemic Asian Indians in North India.
21376264 2011 Impact of unhealthy lifestyle behaviors and obesity on cholesteryl ester transfer protein among adolescent males.
21371711 2011 Cholesteryl ester transfer protein and hepatic lipase gene polymorphisms: effects on hepatic mRNA levels, plasma lipids and carotid atherosclerosis.
21354572 2011 CETP deficiency due to a novel mutation in the CETP gene promoter and its effect on cholesterol efflux and selective uptake into hepatocytes.
21352420 2011 Smaller low-density lipoprotein size as a possible risk factor for the prevalence of coronary artery diseases in haemodialysis patients: associations of cholesteryl ester transfer protein and the hepatic lipase gene polymorphism with low-density lipoprotein size.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21252145 2011 Physical activity modifies the effect of LPL, LIPC, and CETP polymorphisms on HDL-C levels and the risk of myocardial infarction in women of European ancestry.
21185205 The relationship of ACE and CETP gene polymorphisms with cardiovascular disease in a cohort of Asian Indian patients with and those without type 2 diabetes.
21146168 2011 LPL polymorphism (D9N) predicts cardiovascular disease risk directly and through interaction with CETP polymorphism (TaqIB) in women with high HDL cholesterol and CRP.
21062971 2011 Cholesterol metabolism gene polymorphisms and the risk of biliary tract cancers and stones: a population-based case-control study in Shanghai, China.
21039385 2010 The frequency of early, spontaneous miscarriage associated with the leu33pro polymorphism of Glycoprotein IIIa: a pilot study.
20937151 2010 Low cholesteryl ester transfer protein and phospholipid transfer protein activities are the factors making tree shrew and beijing duck resistant to atherosclerosis.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
20835684 2010 [Influence of genetic combinations on HDL-C levels in a Southern Brazilian population].
20822508 2010 Association between CETP Taq1B and LIPC -514C/T polymorphisms with the serum lipid levels in a group of Tehran's population: a cross sectional study.
20799898 2010 Cholesteryl ester transfer protein Taq1B polymorphism in an angiographically assessed Turkish population: no effects on coronary artery disease risk.
20717043 2011 Genetic predisposition to thrombophilia in inflammatory bowel disease.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20581105 2010 Gene-environment interactions of CETP gene variation in a high cardiovascular risk Mediterranean population.
20578904 2010 Common variants of HMGCR, CETP, APOAI, ABCB1, CYP3A4, and CYP7A1 genes as predictors of lipid-lowering response to atorvastatin therapy.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20511482 2010 Cholesteryl ester transfer protein (CETP) genotype and reduced CETP levels associated with decreased prevalence of hypertension.
20494359 2010 LXRalpha regulates human CETP expression in vitro and in transgenic mice.
20489166 2010 Cholesteryl ester transfer protein polymorphism (TaqIB) associates with risk in postinfarction patients with high C-reactive protein and high-density lipoprotein cholesterol levels.
20458649 2010 A CETP polymorphism improves the diagnostic power of clinical examination in patients with cardiovascular disease.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20431066 2010 Restoration of high-density lipoprotein levels by cholesteryl ester transfer protein expression in scavenger receptor class B type I (SR-BI) knockout mice does not normalize pathologies associated with SR-BI deficiency.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20421239 2010 Senescence-related truncation and multimerization of apolipoprotein A-I in high-density lipoprotein with an elevated level of advanced glycated end products and cholesteryl ester transfer activity.
20413969 2010 HDL cholesterol levels in children with mild hypercholesterolemia: effect of consuming skim milk enriched with olive oil and modulation by the TAQ 1B polymorphism in the CETP gene.
20413122 2010 Soluble fibre (Plantago ovata husk) reduces plasma low-density lipoprotein (LDL) cholesterol, triglycerides, insulin, oxidised LDL and systolic blood pressure in hypercholesterolaemic patients: A randomised trial.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20400780 2010 Candidate gene association resource (CARe): design, methods, and proof of concept.
20398902 2010 Common cholesteryl ester transfer protein gene variation related to high-density lipoprotein cholesterol is not associated with decreased coronary heart disease risk after a 10-year follow-up in a Mediterranean cohort: Modulation by alcohol consumption.
20394740 2010 Interaction of common sequence variants and selected risk factors in determination of HDL cholesterol levels.
20385826 2010 Genome-wide association study of advanced age-related macular degeneration identifies a role of the hepatic lipase gene (LIPC).
20385819 2010 Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration.
20370913 2010 Genome-wide association analysis of total cholesterol and high-density lipoprotein cholesterol levels using the Framingham heart study data.
20228163 2010 Prolonged inactivity up-regulates cholesteryl ester transfer protein independently of body fat changes in humans.
20200605 2010 Cholesteryl ester transfer protein gene polymorphisms and longevity syndrome.
20195290 2011 Single nucleotide polymorphisms in genes that are associated with a modified response to statin therapy: the Rotterdam Study.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20160193 2010 Investigation of variants identified in caucasian genome-wide association studies for plasma high-density lipoprotein cholesterol and triglycerides levels in Mexican dyslipidemic study samples.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20138746 2010 TaqIB polymorphism in the CETP gene modulates the impact of HC/LF diet on the HDL profile in healthy Chinese young adults.
20082485 2010 Genetic variants involved in gallstone formation and capsaicin metabolism, and the risk of gallbladder cancer in Chilean women.
20068209 2010 Association of a functional polymorphism in the cholesteryl ester transfer protein (CETP) gene with memory decline and incidence of dementia.
20066028 2010 Modeling of environmental effects in genome-wide association studies identifies SLC2A2 and HP as novel loci influencing serum cholesterol levels.
20065167 2010 Cholesteryl ester transfer protein and mortality in patients undergoing coronary angiography: the Ludwigshafen Risk and Cardiovascular Health study.
20059631 2010 A multilocus candidate approach identifies ACE and HIF1A as susceptibility genes for cellulite.
20031591 2009 Association of blood lipids with common DNA sequence variants at 19 genetic loci in the multiethnic United States National Health and Nutrition Examination Survey III.
20031564 2009 Polymorphism in the CETP gene region, HDL cholesterol, and risk of future myocardial infarction: Genomewide analysis among 18 245 initially healthy women from the Women's Genome Health Study.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
20031538 2008 Genome-wide association analysis of high-density lipoprotein cholesterol in the population-based KORA study sheds new light on intergenic regions.
20026784 2010 Separating the mechanism-based and off-target actions of cholesteryl ester transfer protein inhibitors with CETP gene polymorphisms.
20006332 2010 Influence of menopause and cholesteryl ester transfer protein (CETP) TaqIB polymorphism on lipid profile and HDL subpopulations distribution in women with and without type 2 diabetes.
19956911 2010 The functional and compositional properties of lipoproteins are altered in patients with metabolic syndrome with increased cholesteryl ester transfer protein activity.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19948972 2009 Association of circulating cholesteryl ester transfer protein activity with incidence of cardiovascular disease in the community.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19926784 2010 HDL cholesterol response to GH replacement is associated with common cholesteryl ester transfer protein gene variation (-629C>A) and modified by glucocorticoid treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19850020 2010 Proatherogenic disturbances in lipoprotein profile, associated enzymes and transfer proteins in women with iron deficiency anaemia.
19822408 2011 Association of Taq 1B CETP polymorphism with insulin and HOMA levels in the population of the Canary Islands.
19815603 2010 Lack of association between the cholesteryl ester transfer protein gene--TaqIB polymorphism and coronary restenosis following percutaneous transluminal coronary angioplasty and stenting: a pilot study.
19810818 2009 Combined hepatic lipase -514C/T and cholesteryl ester transfer protein I405V polymorphisms are associated with the risk of coronary artery disease.
19784962 2009 Association of cholesteryl ester transfer protein -629C > A polymorphism with high-density lipoprotein cholesterol levels in coronary artery disease patients.
19773416 2010 A gene score of nine LDL and HDL regulating genes is associated with fluvastatin-induced cholesterol changes in women.
19764573 2009 [Effects of cholesterol ester transfer protein taqIB polymorphism on changes of serum lipid ratios induced by high-carbohydrate/low-fat diet in healthy youth].
19733717 2009 Cholesteryl ester transfer protein, coronary calcium, and intima-media thickness of the carotid artery in middle-age Japanese men.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19728844 2009 TaqIB polymorphism in cholesterol ester transfer protein (CETP) gene predicts future cardiovascular death in patients experiencing an acute coronary syndrome.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19691831 2009 Gene polymorphisms in APOE, NOS3, and LIPC genes may be risk factors for cardiac adverse events after primary CABG.
19689828 2009 Nutrigenetics: links between genetic background and response to Mediterranean-type diets.
19679263 2009 Using new tools to define the genetic underpinnings of risky traits associated with coronary artery disease: the SardiNIA study.
19642912 2009 Lipid profiles and associated gene polymorphisms in young Asian Indian patients with acute myocardial infarction and the metabolic syndrome.
19641010 2009 A deficiency of cholesteryl ester transfer protein whose serum remnant-like particle-triglyceride significantly increased, but serum remnant-like particle-cholesterol did not after an oral fat load.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19564641 2010 CETP does not affect triglyceride production or clearance in APOE*3-Leiden mice.
19558660 2009 Sex-associated effect of CETP and LPL polymorphisms on postprandial lipids in familial hypercholesterolaemia.
19558216 2009 A combination of proatherogenic single-nucleotide polymorphisms is associated with increased risk of coronary artery disease and myocardial infarction in Asian Indians.
19491422 2009 Taq1B polymorphism of cholesteryl ester transfer protein (CETP) gene in primary combined hyperlipidaemia.
19489872 2010 Association of polymorphisms in genes involved in lipoprotein metabolism with plasma concentrations of remnant lipoproteins and HDL subpopulations before and after hormone therapy in postmenopausal women.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19471550 2009 I405V and -629C/A polymorphisms of the cholesteryl ester transfer protein gene in patients with coronary artery disease.
19463799 2009 Lipoprotein profiles in children with two common cholesteryl ester transfer protein gene mutations, D442G and I14A, during the first year of life.
19444232 2009 Association of two CETP polymorphisms with HDL levels in the Chinese obese population.
19428034 2009 Two novel mutations and functional analyses of the CETP and LIPC genes underlying severe hyperalphalipoproteinemia.
19424605 2009 Association of gene polymorphisms with chronic kidney disease in high- or low-risk subjects defined by conventional risk factors.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19417222 2009 Apolipoprotein CI is a physiological regulator of cholesteryl ester transfer protein activity in human plasma but not in rabbit plasma.
19403283 2010 APOE, CETP and LPL genes show strong association with lipid levels in Greek children.
19364639 2010 The effect of a novel intergenic polymorphism (rs11774572) on HDL-cholesterol concentrations depends on TaqIB polymorphism in the cholesterol ester transfer protein gene.
19360375 2010 TAQIB and I405V polymorphisms of CETP are moderately associated with obesity risk in the Chinese adult population.
19359809 2009 Identification of genetic markers associated with high-density lipoprotein-cholesterol by genome-wide screening in a Japanese population: the Suita study.
19345354 2009 Human CETP aggravates atherosclerosis by increasing VLDL-cholesterol rather than by decreasing HDL-cholesterol in APOE*3-Leiden mice.
19341173 Is dyslipidemia sustained during remission of nephrotic syndrome genetically determined? Evaluation of genetic polymorphisms of proteins involved in lipoprotein metabolism in children and adolescents with nephrotic syndrome.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19299407 2009 Replication of genetic associations with plasma lipoprotein traits in a multiethnic sample.
19285487 2009 Genetic determinants of plasma HDL-cholesterol levels in prepubertal children.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19282272 2009 Mechanism of inhibition defines CETP activity: a mathematical model for CETP in vitro.
19273719 2009 Early-life sodium exposure unmasks susceptibility to stroke in hyperlipidemic, hypertensive heterozygous Tg25 rats transgenic for human cholesteryl ester transfer protein.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
19242900 2009 Cholesteryl ester transfer protein I405V polymorphism influences apolipoprotein A-I response to a change in dietary fatty acid composition.
19217440 2009 Influence of cholesteryl ester transfer protein, peroxisome proliferator-activated receptor alpha, apolipoprotein E, and apolipoprotein A-I polymorphisms on high-density lipoprotein cholesterol, apolipoprotein A-I, lipoprotein A-I, and lipoprotein A-I:A-II concentrations: the Prospective Epidemiological Study of Myocardial Infarction study.
19200546 2009 A novel homozygous mutation in CETP gene as a cause of CETP deficiency in a Caucasian kindred.
19193611 2009 Effects of cholesteryl ester transfer protein inhibition on apolipoprotein A-II-containing HDL subspecies and apolipoprotein A-II metabolism.
19191759 2009 Cholesteryl ester transfer protein (CETP) increases postprandial triglyceridaemia and delays triacylglycerol plasma clearance in transgenic mice.
19184337 2009 Association of CETP polymorphisms with the risk of vascular dementia and white matter lesions.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19168039 2009 Cholesteryl ester transfer protein TaqIB, -629C>A and I405V polymorphisms and risk of coronary heart disease in an Indian population.
19165812 2009 I405V and TaqIB polymorphisms of the cholesteryl ester transfer protein and their relation to serum lipid and lipoprotein levels in a Turkish population.
19155782 2009 The environmental and genetic evidence for the association of hyperlipidemia and hypertension.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19147676 2009 Bexarotene induces dyslipidemia by increased very low-density lipoprotein production and cholesteryl ester transfer protein-mediated reduction of high-density lipoprotein.
19140312 [The effect of apolipoprotein e polymorphism on plasma cholesteryl ester transfer protein activity in type 2 diabetic patients].
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19131637 2009 Associations of genetic variants in ATP-binding cassette A1 and cholesteryl ester transfer protein and differences in lipoprotein subclasses in the multi-ethnic study of atherosclerosis.
19099922 2008 [Geographical characteristics of single nucleotide polymorphism of candidate genes associated with coronary artery disease in Chinese Han population].
19086575 2007 One common polymorphism of cholesteryl ester transfer protein gene in Iranian subjects with and without primary hypertriglyceridemia.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19056069 2008 Association of the cholesteryl ester transfer protein Taq1 B2B2 genotype with higher high-density lipoprotein cholesterol concentrations and lower risk of coronary artery disease in a Tunisian population.
19038848 2009 Torcetrapib differentially modulates the biological activities of HDL2 and HDL3 particles in the reverse cholesterol transport pathway.
19038839 2008 A prospective study of high-density lipoprotein cholesterol, cholesteryl ester transfer protein gene variants, and healthy aging in very old Japanese-american men.
19018779 2009 Apolipoprotein E and paraoxonase 1 polymorphisms are associated with lower serum thyroid hormones in postmenopausal women.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18957472 2008 CETP genotype predicts increased mortality in statin-treated men with proven cardiovascular disease: an adverse pharmacogenetic interaction.
18956684 2008 [Study on the correlation between CETP TaqIB, KCNE1 S38G and eNOS T-786C gene polymorphisms for predisposition and non-valvular atrial fibrillation].
18926541 2009 Novel mutations of CETP gene in Italian subjects with hyperalphalipoproteinemia.
18851690 2008 Renin-angiotensin-aldosterone responsiveness to low sodium and blood pressure reactivity to angiotensin-II are unrelated to cholesteryl ester transfer protein mass in healthy subjects.
18849221 2008 CETP TaqIB polymorphism in Turkish adults: association with dyslipidemia and metabolic syndrome.
18841571 2008 [Absence of association of the L296Q polymorphism in the cholesteryl ester transfer protein gene with type 2 diabetes mellitus in Chinese].
18835593 2008 Interactions between alcohol intake and the polymorphism of rs708272 on serum high-density lipoprotein cholesterol levels in the Guangxi Hei Yi Zhuang population.
18823627 2009 Association of lipoprotein lipase D9N polymorphism with myocardial infarction in type 2 diabetes: the genetics, outcomes, and lipids in type 2 diabetes (GOLD) study.
18804459 2008 Higher frequency of abnormal serum angiopoietin-like protein 3 than abnormal cholesteryl ester transfer protein in Japanese hyperalphalipoproteinemic subjects.
18787507 2008 Pharmacological effects of lipid-lowering drugs recapitulate with a larger amplitude the phenotypic effects of common variants within their target genes.
18728123 2008 Methylenetetrahydrofolate reductase C677T polymorphism is associated with central adiposity and increased androgenicity in healthy postmenopausal women.
18680734 2008 CETP polymorphisms influence cholesterol metabolism but not Alzheimer's disease risk.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669886 2008 Niacin increases HDL by reducing hepatic expression and plasma levels of cholesteryl ester transfer protein in APOE*3Leiden.CETP mice.
18667902 2008 Association of TaqIB polymorphism in the cholesteryl ester transfer protein gene with serum lipid levels in the Guangxi Hei Yi Zhuang and Han populations.
18665040 CYP A-204C polymorphism is associated with subclinical atherosclerosis in postmenopausal women.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18637884 2008 Cholesteryl ester transfer protein (CETP) genetic variation and early onset of non-fatal myocardial infarction.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18622260 2008 Common genetic variation in six lipid-related and statin-related genes, statin use and risk of incident nonfatal myocardial infarction and stroke.
18562803 2008 FXRalpha down-regulates LXRalpha signaling at the CETP promoter via a common element.
18560005 2008 Association of cholesteryl ester transfer protein genotypes with CETP mass and activity, lipid levels, and coronary risk.
18549840 2008 Cholesterol ester transfer protein, interleukin-8, peroxisome proliferator activator receptor alpha, and Toll-like receptor 4 genetic variations and risk of incident nonfatal myocardial infarction and ischemic stroke.
18518852 2008 Common variation in the CETP gene and the implications for cardiovascular disease and its treatment: an updated analysis.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18509195 2008 Expression of CETP and of splice variants induces the same level of ER stress despite secretion efficiency differences.
18503096 2008 Cholesteryl ester transfer protein activity and cardiovascular events in patients with chronic kidney disease stage V.
18494281 2008 [The relation between gene of lipoprotein-lipase and carrier protein of cholesterol ethers and life duration in patients with chronic cerebral ischemia].
18468607 2009 Frequency and function of CETP variants among individuals of Asian ancestry.
18454345 2008 Association of cholesteryl ester transfer protein (TaqIB) and apolipoprotein E (HhaI) gene variants with obesity.
18454146 2008 Common genetic variation near MC4R is associated with waist circumference and insulin resistance.
18393253 2008 [Association of CETP and CRP gene polymorphisms with non-valvular atrial fibrillation in Chinese Han population].
18369235 2008 Control of cholesteryl ester transfer protein activity by sequestration of lipid transfer inhibitor protein in an inactive complex.
18354102 2008 Polymorphisms associated with cholesterol and risk of cardiovascular events.
18289550 2008 Synergistic effects of the apolipoprotein E epsilon3/epsilon2/epsilon4, the cholesteryl ester transfer protein TaqIB, and the apolipoprotein C3 -482 C>T polymorphisms on their association with coronary artery disease.
18287799 2008 Cholesteryl ester transfer protein B1B1 genotype is associated with a parental history of cardiovascular diseases in Taiwanese people.
18279878 2008 Probucol markedly reduces HDL phospholipids and elevated prebeta1-HDL without delayed conversion into alpha-migrating HDL: putative role of angiopoietin-like protein 3 in probucol-induced HDL remodeling.
18275964 2008 Low-density lipoprotein and high-density lipoprotein cholesterol levels in relation to genetic polymorphisms and menopausal status: the Atherosclerosis Risk in Communities (ARIC) Study.
18243217 2008 Cholesteryl ester transfer protein genetic polymorphisms, HDL cholesterol, and subclinical cardiovascular disease in the Multi-Ethnic Study of Atherosclerosis.
18239576 2008 The Taq1B-variant in the cholesteryl ester-transfer protein gene and the risk of metabolic syndrome.
18221399 2008 Glucocorticoid replacement is associated with hypertriglyceridaemia, elevated glucose and higher non-HDL cholesterol and may diminish the association of HDL cholesterol with the -629C>A CETP promoter polymorphism in GH-receiving hypopituitary patients.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18187430 2007 The lipoprotein lipase serine 447 stop polymorphism is associated with altered serum carotenoid concentrations in the Stanislas Family Study.
18178167 The ability of plasma to stimulate fibroblast cholesterol efflux is associated with the -629C-->A cholesteryl ester transfer protein promoter polymorphism: role of lecithin: cholesterol acyltransferase activity.
18164013 2008 High HDL cholesterol does not protect against coronary artery disease when associated with combined cholesteryl ester transfer protein and hepatic lipase gene variants.
18064308 2007 Plasma cholesteryl ester transfer protein and blood coagulability.
18063597 2008 Alcohol consumption, TaqIB polymorphism of cholesteryl ester transfer protein, high-density lipoprotein cholesterol, and risk of coronary heart disease in men and women.
18056760 2008 The effect of cholesteryl ester transfer protein overexpression and inhibition on reverse cholesterol transport.
18036514 2008 Cholesteryl ester transfer protein polymorphism D442G associated with a potential decreased risk for Alzheimer's disease as a modifier for APOE epsilon4 in Chinese.
18034366 2008 Lack of replication of genetic associations with human longevity.
18033754 2008 Effects of the cholesteryl ester transfer protein inhibitor torcetrapib on VLDL apolipoprotein E metabolism.
17991755 2008 Association of cholesteryl ester transfer protein with HDL particles reduces its proteolytic inactivation by mast cell chymase.
17991668 2007 Interaction between dietary fat intake and the cholesterol ester transfer protein TaqIB polymorphism in relation to HDL-cholesterol concentrations among US diabetic men.
17970962 2007 Polymorphism in the cholesteryl ester transfer protein gene and the risk of early onset myocardial infarction among cigarette smokers.
17952847 2007 Common single-nucleotide polymorphisms act in concert to affect plasma levels of high-density lipoprotein cholesterol.
17949364 2007 A protective role of a cholesteryl ester transfer protein gene variant towards ischaemic stroke in Sardinians.
17931083 2007 Pharmacogenetic study of cholesteryl ester transfer protein gene and simvastatin treatment in hypercholesterolaemic subjects.
17855807 2007 Maternal and fetal variation in genes of cholesterol metabolism is associated with preterm delivery.
17852818 2008 The association of HDL cholesterol concentration with the -629C>A CETP promoter polymorphism is not fully explained by its relationship with plasma cholesteryl ester transfer.
17848121 2007 Association between the TaqIB polymorphism in the cholesteryl ester transfer protein gene locus and postprandial plasma lipoprotein levels in heterozygotes for familial hypercholesterolemia.
17785925 2007 Common single nucleotide polymorphisms in Japanese patients with essential hypertension: aldehyde dehydrogenase 2 gene as a risk factor independent of alcohol consumption.
17767699 2007 Cholesteryl ester transfer protein gene and coronary heart disease mortality: the Rotterdam study.
17709636 2007 Expression of cholesteryl ester transfer protein in mice promotes macrophage reverse cholesterol transport.
17700364 2007 Contribution of 20 single nucleotide polymorphisms of 13 genes to dyslipidemia associated with antiretroviral therapy.
17666459 2007 The CETP TaqIB polymorphism is associated with the risk of sudden death in type 2 diabetic patients.
17658505 2007 CETP and oxidized LDL levels increase in dyslipidemic subjects.
17615573 2007 Analysis of multiple SNPs in genetic association studies: comparison of three multi-locus methods to prioritize and select SNPs.
17588582 2008 CETP activity variation in mice does not affect two major HDL antiatherogenic properties: macrophage-specific reverse cholesterol transport and LDL antioxidant protection.
17587768 2007 Association of cholesteryl ester transfer protein-TaqIB polymorphyisms with HDL cholesterol levels and the risk of coronary artery disease.
17587762 2007 Human cholestryl ester transfer protein (TaqIB) polymorphism among Filipinos with cardiovascular risk factors.
17568951 2007 Interaction effects of high-density lipoprotein metabolism gene variation and alcohol consumption on coronary heart disease risk: the atherosclerosis risk in communities study.
17568242 2007 The cholesteryl ester transfer protein I405V polymorphism is associated with increased high-density lipoprotein levels and decreased risk of myocardial infarction: the Rotterdam Study.
17555738 2007 Effect of hypoalbuminemia on the increased serum cholesteryl ester transfer protein concentration in children with idiopathic nephrotic syndrome.
17531380 2007 No association of CETP genotype with cognitive function or age-related cognitive change.
17522050 2007 Possible role for intracellular cholesteryl ester transfer protein in adipocyte lipid metabolism and storage.
17519358 2007 CETP genotypes and HDL-cholesterol phenotypes in the HERITAGE Family Study.
17512363 2007 Multiple less common genetic variants explain the association of the cholesteryl ester transfer protein gene with coronary artery disease.
17512305 2007 Cholesteryl ester transfer protein B1B1 genotype as a predictor of coronary artery disease in Taiwanese with type 2 diabetes mellitus.
17503098 2007 The cholesteryl ester transfer protein (CETP) gene and the risk of Alzheimer's disease.
17495597 2007 Concerted actions of cholesteryl ester transfer protein and phospholipid transfer protein in type 2 diabetes: effects of apolipoproteins.
17463246 2007 Genome-wide association analysis identifies loci for type 2 diabetes and triglyceride levels.
17440012 2007 Epistatic effect of cholesteryl ester transfer protein and hepatic lipase on serum high-density lipoprotein cholesterol levels.
17335774 2007 Critical role of cholesterol ester transfer protein in nicotinic acid-mediated HDL elevation in mice.
17318300 2007 The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension.
17311515 2007 Lipid transfer protein activities in subjects with impaired glucose tolerance.
17310124 2007 Cholesteryl ester-transfer protein (CETP) polymorphism and the association of acute coronary syndromes by obesity status in Greek subjects: the CARDIO2000-GENE study.
17293475 2007 Important role for bone marrow-derived cholesteryl ester transfer protein in lipoprotein cholesterol redistribution and atherosclerotic lesion development in LDL receptor knockout mice.
17287950 2007 Cholesteryl ester transfer protein gene haplotypes, plasma high-density lipoprotein levels and the risk of coronary heart disease.
17275808 2007 Cholesteryl ester transfer protein gene polymorphisms are associated with coronary artery disease in Corsican population (France).
17272756 2007 Cholesteryl ester transfer protein (CETP) expression protects against diet induced atherosclerosis in SR-BI deficient mice.
17237796 2007 Crystal structure of cholesteryl ester transfer protein reveals a long tunnel and four bound lipid molecules.
17196207 2008 Effects of cholesterol ester transfer protein (CETP) gene on adiposity in response to long-term overfeeding.
17190939 2006 A genotype of exceptional longevity is associated with preservation of cognitive function.
17160943 2006 [Analysis of cholesterol ester transfer protein gene Taq IB and -629 C/A polymorphisms in patients with endogenous hypertriglyceridemia in Chinese population].
17157861 2007 Associations between HDL-cholesterol and polymorphisms in hepatic lipase and lipoprotein lipase genes are modified by dietary fat intake in African American and White adults.
17108362 2007 High-density genotyping and functional SNP localization in the CETP gene.
17097007 2006 [Effects of cholesterol ester transfer protein Taq1B polymorphism on response of serum HDL-C to dietary factors in hyperlipidemia patients].
17055779 2006 Cholesteryl ester transfer protein (CETP) expression enhances HDL cholesteryl ester liver delivery, which is independent of scavenger receptor BI, LDL receptor related protein and possibly LDL receptor.
17053273 2007 Hepatic lipid accumulation in apolipoprotein C-I-deficient mice is potentiated by cholesteryl ester transfer protein.
16986521 2006 [Association of gene polymorphism at cholesterol ester transfer protein locus with obesity and response to dietary intervention in obesity].
16946130 2006 Cholesteryl ester transfer protein decreases high-density lipoprotein and severely aggravates atherosclerosis in APOE*3-Leiden mice.
16890925 2007 Common variants of Cholesteryl ester transfer protein gene and their association with lipid parameters in healthy volunteers of Tamilian population.
16855190 2006 Cholesteryl ester transfer protein in metabolic syndrome.
16837242 2006 Association of lipoprotein receptor, receptor-associated protein, and metabolizing enzyme gene polymorphisms with gallstone disease: A case-control study.
16829344 2006 Variation in the cholesteryl ester transfer protein (CETP) gene does not influence individual plasma cholesterol response to changes in the nature of dietary fat.
16822236 2006 CETP (cholesteryl ester transfer protein) promoter -1337 C>T polymorphism protects against coronary atherosclerosis in Japanese patients with heterozygous familial hypercholesterolaemia.
16797310 2006 Effects of cholesteryl ester transfer protein TAQ1B polymorphism in renal transplant patients.
16770077 2006 Concordant association of lipid gene variation with a combined HDL/LDL-cholesterol phenotype in two European populations.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16684835 2006 An increased coronary risk is paradoxically associated with common cholesteryl ester transfer protein gene variations that relate to higher high-density lipoprotein cholesterol: a population-based study.
16674961 2007 The association between high-density lipoprotein cholesterol level and cholesteryl ester transfer protein TaqIB gene polymorphism is influenced by alcohol drinking in a population-based sample.
16670775 2006 HDL from CETP-deficient subjects shows enhanced ability to promote cholesterol efflux from macrophages in an apoE- and ABCG1-dependent pathway.
16623947 2006 A role for CETP TaqIB polymorphism in determining susceptibility to atrial fibrillation: a nested case control study.
16563399 2006 CETP levels rather than polymorphisms as markers of coronary risk: healthy athlete with high HDL-C and coronary disease--effectiveness of probucol.
16553359 2006 Cholesteryl ester transfer protein gene polymorphisms and severity of coronary stenosis.
16544732 2006 Candidate gene polymorphism in cardiovascular disease: the BIP cohort.
16542392 2006 Common variants of multiple genes that control reverse cholesterol transport together explain only a minor part of the variation of HDL cholesterol levels.
16522905 2006 Soy-isoflavone-enriched foods and markers of lipid and glucose metabolism in postmenopausal women: interactions with genotype and equol production.
16430904 2006 Association between well-characterized lipoprotein-related genetic variants and carotid intimal medial thickness and stenosis: The Framingham Heart Study.
16426594 2006 The effect of the APOE polymorphism on HDL-C concentrations depends on the cholesterol ester transfer protein gene variation in a Southern European population.
16420563 2006 Multi-locus candidate gene polymorphisms and risk of myocardial infarction: a population-based, prospective genetic analysis.
16384616 I405V polymorphism of the cholesteryl ester transfer protein (CETP) gene in young and very old people.
16343038 2006 Effect of gene polymorphisms on lipoprotein levels in patients with dyslipidemia of metabolic syndrome.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16332659 2005 Soy-isoflavone-enriched foods and inflammatory biomarkers of cardiovascular disease risk in postmenopausal women: interactions with genotype and equol production.
16326978 2006 Description of the torcetrapib series of cholesteryl ester transfer protein inhibitors, including mechanism of action.
16306375 2005 Plasma cholesteryl ester transfer is a determinant of intima-media thickness in type 2 diabetic and nondiabetic subjects: role of CETP and triglycerides.
16306202 2005 Effect of the cholesteryl ester transfer protein genotypes on plasma lipid and lipoprotein levels in Vietnamese children.
16248996 2005 Prevalence of genetic risk factors for coronary artery disease in Corsica island (France).
16205020 2005 Polymorphisms in four genes related to triglyceride and HDL-cholesterol levels in the general Japanese population in 2000.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16159884 2005 Molecular mechanism of the blockade of plasma cholesteryl ester transfer protein by its physiological inhibitor apolipoprotein CI.
16141008 2005 Association of genes of lipid metabolism with measures of subclinical cardiovascular disease in the Diabetes Heart Study.
16123327 2005 Cholesteryl ester transfer protein directly mediates selective uptake of high density lipoprotein cholesteryl esters by the liver.
16098387 2005 Carriers of three polymorphisms of cholesteryl ester transfer protein gene are at increased risk to coronary heart disease in a Chinese population.
16096813 2006 Cholesteryl ester transfer protein (CETP) polymorphism modifies the Alzheimer's disease risk associated with APOE epsilon4 allele.
16086925 2005 Candidate gene susceptibility variants predict intermediate end points but not angiographic coronary artery disease.
16049032 2005 Functional interaction between -629C/A, -971G/A and -1337C/T polymorphisms in the CETP gene is a major determinant of promoter activity and plasma CETP concentration in the REGRESS Study.
16039291 2005 Cholesterol ester transfer protein (CETP) Taq1B polymorphism influences the effect of a standardized cardiac rehabilitation program on lipid risk markers.
16038892 2005 Pharmacogenetic study of apolipoprotein E, cholesteryl ester transfer protein and hepatic lipase genes and simvastatin therapy in Brazilian subjects.
16030523 2005 Genetic determinants of plasma HDL-cholesterol levels in familial hypercholesterolemia.
16005462 2006 Common hepatic lipase gene promoter variant predicts the degree of neointima formation after carotid endarterectomy: impact of plaque composition and lipoprotein phenotype.
16002074 2006 The association of common SNPs and haplotypes in the CETP and MDR1 genes with lipids response to fluvastatin in familial hypercholesterolemia.
15996208 2005 An interaction between the TaqIB polymorphism of cholesterol ester transfer protein and smoking is associated with changes in plasma high-density lipoprotein cholesterol levels in Turks.
15992403 2005 Association of CETP TaqI and APOE polymorphisms with type II diabetes mellitus in North Indians: a case control study.
15979432 2005 Family-based association studies of lipid gene polymorphisms in coronary artery disease.
15955471 2005 Gene polymorphisms affecting HDL-cholesterol levels in the normolipidemic population.
15952120 2005 [Association between insulin resistance and cholesteryl ester transfer protein gene polymorphism in type 2 diabetes mellitus].
15939053 2005 CETP polymorphisms associated with HDL cholesterol may differ from those associated with cardiovascular disease.
15896905 2005 Cholesteryl ester transfer protein TaqI B and lipoprotein lipase Ser447Ter gene polymorphisms are not associated with ischaemic stroke in Greek patients.
15888337 Cholesteryl ester transfer protein (CETP) I405V polymorphism and longevity in Italian centenarians.
15882786 2005 Lack of genetic association of cholesteryl ester transfer protein polymorphisms with late onset Alzheimers disease.
15864114 2005 Genetic and environmental factors affecting the response to statin therapy in patients with molecularly defined familial hypercholesterolaemia.
15859394 [I405V polymorphism of the cholesteryl ester transfer protein gene in young and very old individuals].
15856070 2005 TaqIB polymorphism in CETP gene: the influence on incidence of cardiovascular disease in statin-treated patients with familial hypercholesterolemia.
15840744 2005 The effect of cholesteryl ester transfer protein -629C->A promoter polymorphism on high-density lipoprotein cholesterol is dependent on serum triglycerides.
15811250 2005 Cholesteryl ester transfer protein TaqIB polymorphism in the cholesterol and recurrent events study.
15766738 2005 Association of plasma cholesteryl ester transfer protein activity and polymorphism with coronary artery disease extent in Tunisian type II diabetic patients.
15696473 2005 [Single nucleotide polymorphisms of genes associated with high density lipoprotein metabolism in Chinese population].
15655129 2005 Cholesteryl ester transfer protein TaqIB variant, high-density lipoprotein cholesterol levels, cardiovascular risk, and efficacy of pravastatin treatment: individual patient meta-analysis of 13,677 subjects.
15608561 2004 Response to micronized fenofibrate treatment is associated with the peroxisome-proliferator-activated receptors alpha G/C intron7 polymorphism in subjects with type 2 diabetes.
15589073 2004 Cholesteryl ester transfer protein TaqIB polymorphism and its relation to parameters of the insulin resistance syndrome in an Austrian cohort.
15585206 2005 Relationship between gene polymorphisms and prevalence of myocardial infarction among diabetic and non-diabetic subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15450208 2004 Highly polymorphic repeat region in the CETP promoter induces unusual DNA structure.
15382463 2004 [Role of cholesteryl ester transfer protein activity and genetic polymorphism in ischemic heart disease in type 2 diabetic patients].
15377415 2004 Association between cholesteryl ester transfer protein gene polymorphisms and variations in lipid levels in patients with coronary heart disease.
15339254 2005 Apolipoprotein CI overexpression is not a relevant strategy to block cholesteryl ester transfer protein (CETP) activity in CETP transgenic mice.
15256516 2004 Lipid-related genes and myocardial infarction in 4685 cases and 3460 controls: discrepancies between genotype, blood lipid concentrations, and coronary disease risk.
15228446 2004 Expression of cholesteryl ester transfer protein (CETP) in germinal centre B cells and their neoplastic counterparts.
15138631 2004 Taq1B polymorphism of CETP gene on lipid abnormalities in patients with type II diabetes mellitus.
15102891 2004 Postprandial chylomicrons: potent vehicles for transporting cholesterol from endogenous LDL+HDL and cell membranes to the liver via LCAT and CETP.
15099350 2004 Variations in high-density lipoprotein cholesterol in relation to physical activity and Taq 1B polymorphism of the cholesteryl ester transfer protein gene.
15098490 2004 [Relationship between gene polymorphism at CETP locus and hyperlipidemia in the middle-aged and the elder].
15085362 2004 [Genetic variation of the cholesterol ester transfer protein gene and the prevalence of coronary artery disease. The AtheroGene case control study].
15076187 2004 Genetic influences on blood pressure within the Stanislas Cohort.
15053158 2004 Role of genetic factors (CETP gene Taq I B polymorphism and Apo A-I gene Msp I polymorphism) in serum HDL-C levels in women.
15039125 2004 Genotypes and haplotypes predisposing to myocardial infarction: a multilocus case-control study.
15036597 2004 An association study of the cholesteryl ester transfer protein TaqI B polymorphism with late onset Alzheimer's disease.
14998629 2004 The cholesteryl ester transfer protein (CETP) TaqIB polymorphism in the cholesterol and recurrent events study: no interaction with the response to pravastatin therapy and no effects on cardiovascular outcome: a prospective analysis of the CETP TaqIB polymorphism on cardiovascular outcome and interaction with cholesterol-lowering therapy.
14967821 2004 A prospective study of HDL-C and cholesteryl ester transfer protein gene mutations and the risk of coronary heart disease in the elderly.
14732872 2004 A novel missense mutation (L296 Q) in cholesteryl ester transfer protein gene related to coronary heart disease.
14687732 2004 Apolipoprotein E and cholesteryl ester transfer protein polymorphisms in normal and preeclamptic pregnancies.
14679166 2004 Cholesteryl ester transfer protein modulates the effect of liver X receptor agonists on cholesterol transport and excretion in the mouse.
14669156 2003 Association of cholesteryl ester transfer protein activity and TaqIB polymorphism with lipoprotein variations in Japanese subjects.
14660992 2003 The cholesteryl ester transfer protein Taq1B gene polymorphism predicts clinical benefit of statin therapy in patients with significant coronary artery disease.
14583798 2003 Haplotypes of the cholesteryl ester transfer protein gene predict lipid-modifying response to statin therapy.
14563342 2003 A polymorphism of the cholesteryl ester transfer protein gene predicts cardiovascular events in non-smokers in the West of Scotland Coronary Prevention Study.
14559957 2003 Unique lipoprotein phenotype and genotype associated with exceptional longevity.
14531818 2003 Hepatic lipase mutation may reduce vascular disease prevalence in hemodialysis patients with high CETP levels.
12966036 2003 Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors.
12951364 2003 CETP and lipid transfer inhibitor protein are uniquely affected by the negative charge density of the lipid and protein domains of LDL.
12919138 2003 Cholesterol ester transfer protein, apolipoprotein E and lipoprotein lipase genotypes in patients with coronary artery disease in the Turkish population.
12907677 2003 Lipid transfer inhibitor protein defines the participation of high density lipoprotein subfractions in lipid transfer reactions mediated by cholesterol ester transfer protein (CETP).
12871320 2003 Lipid metabolism and occurrence of post-percutaneous transluminal coronary angioplasty restenosis: role of cholesteryl ester transfer protein and paraoxonase/arylesterase.
12840632 2003 No physical activity x CETP 1b.-629 interaction effects on lipid profile.
12820950 2003 [Study on the distribution and association of cholesteryl ester transfer protein-TaqIB polymorphism and plasma concentration in general population].
12818414 2003 Influence of common variants in the CETP, LPL, HL and APO E genes on LDL heterogeneity in healthy, middle-aged men.
12818401 2003 Polymorphisms in the CETP gene and association with CETP mass and HDL levels.
12798569 2003 Common genetic variation of the cholesteryl ester transfer protein gene strongly predicts future cardiovascular death in patients with coronary artery disease.
12791674 2003 Cholesteryl ester transfer protein expression prevents diet-induced atherosclerotic lesions in male db/db mice.
12773093 2003 Association between the cholesteryl ester transfer protein TaqI-detectable B polymorphism and low high-density lipoprotein cholesterol concentration in Saudis.
12771549 2002 Single nucleotide polymorphism haplotypes in the cholesteryl-ester transfer protein (CETP) gene and lipid phenotypes.
12771320 2003 The human cholesteryl ester transfer protein I405V polymorphism is associated with plasma cholesterol concentration and its reduction by dietary phytosterol esters.
12730302 2003 Regulation of human CETP gene expression: role of SP1 and SP3 transcription factors at promoter sites -690, -629, and -37.
12700892 2003 Haplotype analyses of cholesteryl ester transfer protein gene promoter: a clue to an unsolved mystery of TaqIB polymorphism.
12669678 2002 Interaction between a common variant of the cholesteryl ester transfer protein gene and the apolipoprotein E polymorphism: effects on plasma lipids and lipoproteins in a cohort of 7-year-old children.
12663600 2003 Common cholesteryl ester transfer protein gene polymorphisms and the effect of atorvastatin therapy in type 2 diabetes.
12639975 2003 Natural genetic variation as a tool in understanding the role of CETP in lipid levels and disease.
12601526 2003 Deficiency of choresteryl ester transfer protein and gene polymorphisms of lipoprotein lipase and hepatic lipase are not associated with longevity.
12588754 2003 Cholesteryl ester transfer protein: a novel target for raising HDL and inhibiting atherosclerosis.
12579494 2003 [Study on the association of cholesteryl ester transfer protein gene mutations with the susceptibility to coronary atherosclerotic heart disease].
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12519369 2003 The association of cholesteryl ester transfer protein polymorphism with high-density lipoprotein cholesterol and coronary artery disease in Koreans.
12519368 2003 The TaqIB and -629C>A polymorphisms at the cholesteryl ester transfer protein locus: associations with lipid levels in a multiethnic population. The 1998 Singapore National Health Survey.
12518020 2003 Cholesteryl ester transfer protein expression attenuates atherosclerosis in ovariectomized mice.
12514935 2002 Loci for CETP, LPL, LIPC, and APOC3 affect plasma lipoprotein size and sub-population distribution in Hispanic and non-Hispanic white subjects: the Columbia University BioMarkers Study.
12499392 2003 Haplotype analysis of the CETP gene: not TaqIB, but the closely linked -629C-->A polymorphism and a novel promoter variant are independently associated with CETP concentration.
12482565 2003 Prevalence and phenotypic spectrum of cholesteryl ester transfer protein gene mutations in Japanese hyperalphalipoproteinemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446192 2002 Analysis of several hundred genetic polymorphisms may improve assessment of the individual genetic burden for coronary artery disease.
12409629 2002 Effect of HMG-CoA reductase inhibitor on plasma cholesteryl ester transfer protein activity in primary hypercholesterolemia: comparison among CETP/TaqIB genotype subgroups.
12401886 2002 Elevation of plasma phospholipid transfer protein in transgenic mice increases VLDL secretion.
12174215 2002 Genetic and environmental determinants of plasma high density lipoprotein cholesterol and apolipoprotein AI concentrations in healthy middle-aged men.
12164095 2002 A common mutation in cholesteryl ester transfer protein gene and plasma HDL cholesterol level before and after hormone replacement therapy in Korean postmenopausal women.
12116231 2002 Candidate genes involved in cardiovascular risk factors by a family-based association study on the island of Kosrae, Federated States of Micronesia.
12104085 2002 CETP gene mutation (D442G) increases low-density lipoprotein particle size in patients with coronary heart disease.
12091484 2002 Two novel missense mutations in the CETP gene in Japanese hyperalphalipoproteinemic subjects: high-throughput assay by Invader assay.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12070157 2002 Apolipoprotein CI deficiency markedly augments plasma lipoprotein changes mediated by human cholesteryl ester transfer protein (CETP) in CETP transgenic/ApoCI-knocked out mice.
12055319 2002 Increased serum cholesteryl ester transfer protein in obese children.
12048136 2002 The frequency of the cholesteryl ester transfer protein-TaqI B2 allele is lower in African Americans than in Caucasians.
12033532 2002 Association of human cholesteryl ester transfer protein-TaqI polymorphisms with serum HDL cholesterol levels in a normolipemic Japanese rural population.
12019635 2002 Rapid communication: genetic linkage and physical mapping of the porcine cholesteryl ester transfer protein (CETP) gene.
11996962 2002 Association between HDL-cholesterol and the Taq1B polymorphism in the cholesterol ester transfer protein gene in obese women.
11956670 2002 Allele and genotype frequencies of polymorphic DCP1, CETP, ADRB2, and HTR2A in the Egyptian population.
11952809 2002 Relationship of genetic variation in genes encoding apolipoprotein A-IV, scavenger receptor BI, HMG-CoA reductase, CETP and apolipoprotein E with cholesterol metabolism and the response to plant stanol ester consumption.
11888533 2002 A prospective study of TaqIB polymorphism in the gene coding for cholesteryl ester transfer protein and risk of myocardial infarction in middle-aged men.
11888509 2002 A novel cholesteryl ester transfer protein promoter polymorphism (-971G/A) associated with plasma high-density lipoprotein cholesterol levels. Interaction with the TaqIB and -629C/A polymorphisms.
11882335 2002 Unique character and metabolism of high density lipoprotein (HDL) in fetus.
11872695 2002 Relationship between TaqIB cholesteryl ester transfer protein gene polymorphism and macrovascular complications in Japanese patients with type 2 diabetes.
11804197 2001 Genetic variations of cholesterol ester transfer protein gene in Koreans.
11730826 2001 Influence of CETP gene variation on plasma lipid levels and coronary heart disease: a survey in Taiwan.
11714857 2001 Genetic influences on lipid metabolism trait variability within the Stanislas Cohort.
11689220 2001 The -629C>A polymorphism in the CETP gene does not explain the association of TaqIB polymorphism with risk and age of myocardial infarction in Icelandic men.
11575217 2001 [APOC3, CETP, beta-fibrinogen and MTHFR are genetic determinants of carotid intim-media thickness (Stanislas cohort)].
11533368 2001 Age-related effects of genetic variation on lipid levels: The Columbia University BioMarkers Study.
11454014 2001 Variation at the cholesteryl ester transfer protein gene in relation to plasma high density lipoproteins cholesterol levels and carotid intima-media thickness.
11398140 2001 Association between the TaqIB polymorphism in the cholesteryl ester transfer protein gene locus and plasma lipoprotein levels in familial hypercholesterolemia.
11369008 2001 Cholesteryl ester transfer protein polymorphism associated with macroangiopathy in Japanese patients with type 2 diabetes.
11359462 2001 APOC3, CETP, fibrinogen, and MTHFR are genetic determinants of carotid intima-media thickness in healthy men (the Stanislas cohort).
11341749 2001 Candidate gene polymorphisms in cardiovascular disease: a comparative study of frequencies between a French and an Italian population.
11322655 2001 Effects of hepatic lipase gene promoter nucleotide variations on serum HDL cholesterol concentration in the general Japanese population.
11284423 2001 [Polymorphisms in genes for cholesterol ester transfer protein, apolipoprotein C-III and lipoprotein lipase in children with high and low cholesterol levels] ].
11096142 2000 Lack of relationship in long-term type 1 diabetic patients between diabetic nephropathy and polymorphisms in apolipoprotein epsilon, lipoprotein lipase and cholesteryl ester transfer protein. Genétique de la Nephropathie Diabétique Study Group. Données Epidémiologiques sur le Syndrome d'Insulino-Résistance Study Group.
11056092 2000 Common cholesteryl ester transfer protein mutations, decreased HDL cholesterol, and possible decreased risk of ischemic heart disease: The Copenhagen City Heart Study.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9712344 1998 Relationship of adipose tissue cholesteryl ester transfer protein (CETP) mRNA to plasma concentrations of CETP in man.
9374130 1997 Relationship between lipoprotein lipase and high density lipoprotein cholesterol in mice: modulation by cholesteryl ester transfer protein and dietary status.
9332354 1997 Sequencing of the cholesteryl ester transfer protein 5' regulatory region using artificial transposons.
9305883 1997 Differential interaction of the human cholesteryl ester transfer protein with plasma high density lipoproteins (HDLs) from humans, control mice, and transgenic mice to human HDL apolipoproteins. Lack of lipid transfer inhibitory activity in transgenic mice expressing human apoA-I.
8943225 1996 Human cholesteryl ester transfer protein gene proximal promoter contains dietary cholesterol positive responsive elements and mediates expression in small intestine and periphery while predominant liver and spleen expression is controlled by 5'-distal sequences. Cis-acting sequences mapped in transgenic mice.
8494888 1993 Human plasma cholesteryl ester transfer protein consists of a mixture of two forms reflecting variable glycosylation at asparagine 341.
8408659 1993 A missense mutation in the cholesteryl ester transfer protein gene with possible dominant effects on plasma high density lipoproteins.
8132678 1994 Complete cDNA encoding human phospholipid transfer protein from human endothelial cells.
7989465 1994 Cholesteryl ester transfer protein gene: two common mutations and their effect on plasma high-density lipoprotein cholesterol content.
7583561 1995 Triglycerides are major determinants of cholesterol esterification/transfer and HDL remodeling in human plasma.
3818596 1987 Purification and characterization of a human plasma cholesteryl ester transfer protein.
3600759 1987 Cloning and sequencing of human cholesteryl ester transfer protein cDNA.
3446583 1987 Assignment of the human gene for cholesteryl ester transfer protein to chromosome 16q12-16q21.
3104518 1986 Distribution and localization of lecithin:cholesterol acyltransferase and cholesteryl ester transfer activity in A-I-containing lipoproteins.
2833496 1988 Plasma cholesteryl ester transfer protein has binding sites for neutral lipids and phospholipids.
2586614 1989 Molecular basis of lipid transfer protein deficiency in a family with increased high-density lipoproteins.
2390095 1990 Total deficiency of plasma cholesteryl ester transfer protein in subjects homozygous and heterozygous for the intron 14 splicing defect.
2334701 1990 Organization of the human cholesteryl ester transfer protein gene.
2215607 1990 Increased high-density lipoprotein levels caused by a common cholesteryl-ester transfer protein gene mutation.
1999438 1991 Mammalian adipose tissue and muscle are major sources of lipid transfer protein mRNA.