Property Summary

NCBI Gene PubMed Count 21
PubMed Score 78.33
PubTator Score 17.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.200 2.4e-02
hepatocellular carcinoma 1.700 6.8e-05
Waldenstrons macroglobulinemia 1.775 1.1e-03
Multiple myeloma 1.165 1.0e-02
malignant mesothelioma 1.100 3.3e-06
psoriasis 1.500 3.0e-04
posterior fossa group B ependymoma 1.500 7.0e-07
group 4 medulloblastoma 1.700 1.3e-05
tuberculosis and treatment for 6 months -1.200 1.5e-04
lung carcinoma 1.100 6.7e-11
acute myeloid leukemia -2.500 2.1e-02
ovarian cancer -2.000 4.5e-08
Down syndrome 1.100 4.5e-03
dermatomyositis 1.500 4.7e-03

 GO Function (1)

Gene RIF (4)

PMID Text
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
20508983 Observational study of gene-disease association. (HuGE Navigator)
16101678 Studies using a combined approach of immunofluorescence detection of Gag protein and in situ hybridization detection of viral genomic RNA indicate Gag co-localizes with Psi+ RNA in the perinuclear region and also co-localizes with centrins
15654740 could be classified as a Ca(2+) sensor protein

AA Sequence

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL      1 - 70
KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR     71 - 140
AMIEEFDKDGDGEINQEEFIAIMTGDI                                               141 - 167
//

Text Mined References (24)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
26337392 2015 MDM1 is a microtubule-binding protein that negatively regulates centriole duplication.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19734900 2009 Genetic variant near IRS1 is associated with type 2 diabetes, insulin resistance and hyperinsulinemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15654740 2005 Calcium and magnesium binding to human centrin 3 and interaction with target peptides.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14731449 1995 In search of a function for centrins.
14711432 2004 Centrosomes: Sfi1p and centrin unravel a structural riddle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279195 2001 Phosphorylation of centrin during the cell cycle and its role in centriole separation preceding centrosome duplication.
10725219 2000 Differential expression and cellular distribution of centrin isoforms during human ciliated cell differentiation in vitro.
9843852 1998 Differential regulation of centrin genes during ciliogenesis in human tracheal epithelial cells.
9256449 1997 Identification of a new mammalian centrin gene, more closely related to Saccharomyces cerevisiae CDC31 gene.
9004043 1996 Most of centrin in animal cells is not centrosome-associated and centrosomal centrin is confined to the distal lumen of centrioles.
8798410 1996 Characterization of green alga, yeast, and human centrins. Specific subdomain features determine functional diversity.