Property Summary

NCBI Gene PubMed Count 58
PubMed Score 82.37
PubTator Score 65.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.400 3.3e-17
medulloblastoma, large-cell -1.300 1.0e-03
Breast cancer 3.400 2.8e-02
nasopharyngeal carcinoma -1.200 8.4e-04
ovarian cancer 1.800 1.0e-03
chronic rhinosinusitis -1.712 3.7e-02
dermatomyositis 1.100 1.1e-03

 GO Function (1)

Gene RIF (29)

PMID Text
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
25753040 Centrin2 regulates primary ciliogenesis through controlling CP110 levels.
24291146 co-depletion of centrin 2 and PCID2 leads to blocking rather than delaying nuclear protein export, indicating the dominance of the centrin 2 phenotype.
23844208 Data indicate that overexpression of the centrin interactor POC5 leads to the assembly of linear, centrin-dependent structures.
23840880 CDC25B, through activation of a centrosomal pool of CDK2, stabilises the local pool of Mps1 which in turn regulates the level of centrin 2 at the centrosome.
22809153 Cen2 influences the binding of RPA and XPA with damaged DNA.
21731694 The stability of centrin is regulated in part by Aurora A.
21676658 xeroderma pigmentosum complementation group C expression correlates with a decreased amount of CENTRIN 2 transcript and protein
21091437 CDC25B forms a close association with Ctn-2 proteins at the centrosome.
20980622 Mps1-dependent phosphorylation of Cetn2 stimulates the canonical centriole assembly pathway.
20586543 oxidative radicals induce high proportions of irreversible damages (polymerisation) centrin 2 is highly sensitive to ionising radiation.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19857500 The structure of C-HsCen2 [the C-terminal domain of HsCen2 (T94-Y172)] in complex with R17-hSfi1-20 was determined.
19706679 The nucleocytoplasmic shuttling of centrin-2 depends on the SUMO system.
19179680 lower centrin levels in oligoasthnozoospermic males resulted in lower pregnancy percentage in this group after ICSI.
18177054 NMR analysis indicates that the physical interaction between C-XPC and centrin 2 induces only minor conformational changes into XPC, localized around the 17-mer segment (847-863), showed to be critically involved in the centrin binding.
18172010 CETN2 localizes to the vertebrate nuclear pore and plays a role in mRNA and protein export.
17897675 The present data confirm that the in vitro structural features of the centrin/XPC peptide complex are highly relevant to the cellular context.
17603931 Centrin 2 is highly sensitive to ionizing radiation, which could have important consequences on its biological functions.
16820684 A complex formed by a Ca2+-bound human centrin 2 with a 17-mer peptide derived from the XPC sequence was crystallized.
16627479 the crystal structure of calcium-loaded full-length centrin-2 complexed with a xeroderma pigmentosum group C peptide; a novel binding motif for centrin
16411764 an 18-residue peptide, from the N-terminal unstructured fragment, has a significant affinity for the isolated C-terminal domain, suggesting an active role in the self-assembly of centrin molecules.
16101678 HIV-1 Vpr-expressing HeLa cells stained with centriole markers pericentrin, gamma-tubulin, and Cen2 contain multiple pairs of centrioles scattered in the perinuclear region, indicating Vpr causes the accumulation of multiple centrosome-like structures
15964821 Centrin 2 stimulates nucleotide excision repair by interacting with XPC.
15356003 Results describe the self-assembly properties of purified human centrin-2 in vitro.
14767062 HIV-1 Vpr-expressing HeLa cells stained with centriole markers pericentrin, gamma-tubulin, and Cen2 contain multiple pairs of centrioles scattered in the perinuclear region, indicating Vpr causes the accumulation of multiple centrosome-like structures
12890685 structural characterization of the complex formed by the C-terminal domain of Cen2 with a peptide of xeroderma pigmentosum group C protein
12578356 The solution structure of the long C-terminal fragment of centrin 2 exhibits an open two EF-hand structure, similar to the conformation of related Ca(2+)-saturated regulatory domains.
12176356 required for centriole duplication in mammalian cells

AA Sequence

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIK      1 - 70
KMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE     71 - 140
ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY                                          141 - 172
//

Text Mined References (69)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
25753040 2015 Centrin2 regulates CP110 removal in primary cilium formation.
25416956 2014 A proteome-scale map of the human interactome network.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24291146 2014 Human TREX2 components PCID2 and centrin 2, but not ENY2, have distinct functions in protein export and co-localize to the centrosome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23844208 2013 Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair.
23840880 2013 CDC25B overexpression stabilises centrin 2 and promotes the formation of excess centriolar foci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22809153 2012 Influence of centrin 2 on the interaction of nucleotide excision repair factors with damaged DNA.
22349705 2012 STIL is required for centriole duplication in human cells.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
21962512 2011 A DNA repair complex functions as an Oct4/Sox2 coactivator in embryonic stem cells.
21731694 2011 Control of centrin stability by Aurora A.
21676658 2011 Differential contribution of XPC, RAD23A, RAD23B and CENTRIN 2 to the UV-response in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21091437 2011 CDC25B associates with a centrin 2-containing complex and is involved in maintaining centrosome integrity.
20980622 2010 Mps1 phosphorylation sites regulate the function of centrin 2 in centriole assembly.
20586543 2010 Oxidative stress induces mainly human centrin 2 polymerisation.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19857500 2010 Structure, dynamics and thermodynamics of the human centrin 2/hSfi1 complex.
19706679 2009 SUMO-dependent regulation of centrin-2.
19179680 2008 Human sperm centrin levels & outcome of intracytoplasmic sperm injection (ICSI)--a pilot study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18177054 2008 The carboxy-terminal domain of xeroderma pigmentosum complementation group C protein, involved in TFIIH and centrin binding, is highly disordered.
18172010 2008 Centrin 2 localizes to the vertebrate nuclear pore and plays a role in mRNA and protein export.
17897675 2007 Structural, thermodynamic, and cellular characterization of human centrin 2 interaction with xeroderma pigmentosum group C protein.
17603931 2007 High sensitivity of human centrin 2 toward radiolytical oxidation: C-terminal tyrosinyl residue as the main target.
17154534 2006 Biochemical and structural domain analysis of xeroderma pigmentosum complementation group C protein.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16956364 2006 Binding of human centrin 2 to the centrosomal protein hSfi1.
16820684 2006 Crystallization and preliminary X-ray diffraction data of the complex between human centrin 2 and a peptide from the protein XPC.
16760425 2006 CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability.
16627479 2006 The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
16533048 2006 Flexibility and plasticity of human centrin 2 binding to the xeroderma pigmentosum group C protein (XPC) from nuclear excision repair.
16464125 2006 p16(INK4a) prevents centrosome dysfunction and genomic instability in primary cells.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16411764 2006 The N-terminal domain of human centrin 2 has a closed structure, binds calcium with a very low affinity, and plays a role in the protein self-assembly.
16381901 2006 The LIFEdb database in 2006.
15964821 2005 Centrin 2 stimulates nucleotide excision repair by interacting with xeroderma pigmentosum group C protein.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356003 2004 Calcium-dependent self-assembly of human centrin 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504268 2003 Sfi1p has conserved centrin-binding sites and an essential function in budding yeast spindle pole body duplication.
12890685 2003 Xeroderma pigmentosum group C protein possesses a high affinity binding site to human centrin 2 and calmodulin.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12802058 2003 Centrin4p, a novel mammalian centrin specifically expressed in ciliated cells.
12578356 2003 C-terminal half of human centrin 2 behaves like a regulatory EF-hand domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12176356 2002 Centrin-2 is required for centriole duplication in mammalian cells.
11279143 2001 Centrosome protein centrin 2/caltractin 1 is part of the xeroderma pigmentosum group C complex that initiates global genome nucleotide excision repair.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
10788612 2000 Cation- and peptide-binding properties of human centrin 2.
9665797 1998 Expression of centrin isoforms in the mammalian retina.
8597638 1995 Refined mapping of caltractin in human Xq28 and in the homologous region of the mouse X chromosome places the gene within the bare patches (Bpa) and striated (Str) critical regions.
8248209 1993 Molecular cloning and centrosomal localization of human caltractin.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7713520 1994 Assignment of the human caltractin gene (CALT) to Xq28 by fluorescence in situ hybridization.