Property Summary

NCBI Gene PubMed Count 15
PubMed Score 35.82
PubTator Score 13.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 3.0e-38
ulcerative colitis 2087 8.2e-05
osteosarcoma 7933 1.1e-04
Disease Target Count Z-score Confidence
tuberculosis 1563 4.522 2.3
Dental pulp necrosis 7 3.304 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 3.0e-38
osteosarcoma 1.136 1.1e-04
ulcerative colitis -1.600 8.2e-05

Protein-protein Interaction (1)

Gene RIF (5)

PMID Text
22700792 This study provides the first evidence of functional compensation whereby increased expression of CES3 restores intracellular cholesteryl ester hydrolytic activity and free cholesterol efflux in CES1-deficient cells.
20529763 Observational study of gene-disease association. (HuGE Navigator)
20422440 Studies indicate that CES3 mRNA isoform expression in several tissues, particularly in colon, trachea and in brain.
19508181 CES3 seems to have a lower catalytic efficiency than the other two CESs for selected substrates.
18794728 pharmacogenomic characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes

AA Sequence

MERAVRVESGVLVGVVCLLLACPATATGPEVAQPEVDTTLGRVRGRQVGVKGTDRLVNVFLGIPFAQPPL      1 - 70
GPDRFSAPHPAQPWEGVRDASTAPPMCLQDVESMNSSRFVLNGKQQIFSVSEDCLVLNVYSPAEVPAGSG     71 - 140
RPVMVWVHGGALITGAATSYDGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFLDVVAALRWVQ    141 - 210
ENIAPFGGDLNCVTVFGGSAGGSIISGLVLSPVAAGLFHRAITQSGVITTPGIIDSHPWPLAQKIANTLA    211 - 280
CSSSSPAEMVQCLQQKEGEELVLSKKLKNTIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSW    281 - 350
LIPRGWGLLDTMEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINV    351 - 420
PTVSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPAWVKADHGAEGAFVFGGPFLMDESSRLAFPEATEEEK    421 - 490
QLSLTMMAQWTHFARTGDPNSKALPPWPQFNQAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQ    491 - 560
KQKNRKAQEDL                                                               561 - 571
//

Text Mined References (19)

PMID Year Title
22700792 2012 Identification of a novel intracellular cholesteryl ester hydrolase (carboxylesterase 3) in human macrophages: compensatory increase in its expression after carboxylesterase 1 silencing.
20931200 2010 Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20422440 2010 Mammalian carboxylesterase 3: comparative genomics and proteomics.
19508181 2009 Human carboxylesterases: an update on CES1, CES2 and CES3.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18794728 2008 Structure and characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15687373 2005 Hydrolysis of capecitabine to 5'-deoxy-5-fluorocytidine by human carboxylesterases and inhibition by loperamide.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15100172 2004 Hydrolysis of irinotecan and its oxidative metabolites, 7-ethyl-10-[4-N-(5-aminopentanoic acid)-1-piperidino] carbonyloxycamptothecin and 7-ethyl-10-[4-(1-piperidino)-1-amino]-carbonyloxycamptothecin, by human carboxylesterases CES1A1, CES2, and a newly expressed carboxylesterase isoenzyme, CES3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14581373 2003 Carboxylesterases expressed in human colon tumor tissue and their role in CPT-11 hydrolysis.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
7916639 1993 Cloning and nucleotide sequence of a novel, male-predominant carboxylesterase in mouse liver.