Property Summary

NCBI Gene PubMed Count 56
PubMed Score 251.92
PubTator Score 318.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.580 8.5e-03
Becker muscular dystrophy 1.065 5.0e-05
acute quadriplegic myopathy 1.461 4.4e-06
pancreatic ductal adenocarcinoma liver m... -1.235 4.0e-02
intraductal papillary-mucinous neoplasm ... 2.300 2.4e-03
colon cancer -1.700 7.5e-03
active Crohn's disease -1.330 2.0e-02
ulcerative colitis -2.000 2.0e-06
ovarian cancer 1.300 1.5e-05

Gene RIF (44)

PMID Text
26025324 Findings suggest that CES2 expression and activity, by mediating the intratumoral activation of irinotecan, is a contributor to FOLFIRINOX sensitivity in pancreatic cancer.
25724353 In the liver and duodenum, CES2 mRNA expression increased and exhibited a postnatal surge.
24212379 After oral administration of dabigatran etexilate to humans, DABE is hydrolyzed by intestinal CES2 to the intermediate M2 metabolite followed by hydrolysis of M2 to DAB in the liver by CES1.
24195516 expression of CES2, UGTA1A1, and GUSB varies in colorectal pathology tissues and that the expression of CES2 is somewhat related to tumor staging.
23480903 CES2 RNA expression was observed in neuroblastoma cells, and its expression in neuroblastoma cell lines was positively correlated with sensitivity to CPT-11 and apoptosis after CPT-11 exposure in vitro
23471941 Variations in CES2 in the promoter region, may alter rifampicin metabolism by affecting expression of the gene
22525521 tested the hypothesis that an individual's CES phenotype can be characterized by reporter substrates/probes that interrogate native CES1 and CES2 activities in liver and immunoblotting methods
20649590 Report CES2 mediated hydrolysis of heroin, cocaine and CPT-11.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20195289 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19856659 serum carboxylesterase-2 level might be a potential marker in the diagnosis of the early stage ovarian cancer.
19508181 A comparison of the substrate specificity of CES1 versus CES2 reveals broad but distinct substrate preferences.
19349540 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19274604 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18983829 Carboxylesterases play critical roles in drug metabolism and insecticide detoxication; findings show large variability among different age groups or even within the same age group.
18797458 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18794728 pharmacogenomic characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes
18473752 an association between a polymorphism in the CES2 gene and the efficacy of capecitabine has been described
18473752 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18305377 Carboxylesterase 1A2 has been isolated and determined to be identical to carboxylesterase 1A1 except for exon 1 and the 5' regulatory element.
18259949 Carboxylesterase 2 is downregulated in colorectal cancer following progression of the disease
17764701 comparative analysis of CES1 and CES2 in liver and small intestine of humans, monkeys, dogs, rabbits and rats
17640957 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17640957 In a Japanese population, CES2 haplotypes and a defective allele were associated with a decrease in enzyme levels or activity. Pharmacokinetics of irinotecan was evaluated in cancer patients.
17537833 IL-6 alters the cellular responsiveness to clopidogrel, irinotecan, and oseltamivir by suppressing the expression of CES2.
17483951 830C>G single nucleotide polymorphism of CES2 is unlikely to have significant functional consequences on CES2 expression, activity or function
17483951 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16963839 p53 directly regulates CES-2 expression in a colonic cancer cell line.
16690525 in diffuse large B-cell lymphoma, molecular alterations in ice, bcl-2, c-myc and p53 are present in hematopoietic cells from bone marrow as well as in primitive hematopoietic progenitors
15967118 TFF-1 is lost late in the progression from Barrett's Esophagus to adenocarcinoma, while CES-2 is upregulated
15592324 Observational study of genotype prevalence. (HuGE Navigator)
15592324 human carboxylesterase 2 gene presents several polymorphisms, none of which seems to be involved in significant variations in protein activity
15475733 Observational study of gene-disease association. (HuGE Navigator)
15475733 analysis of single nucleotide polymorphisms and haplotype structure of the human carboxylesterase 2 gene
15475243 Observational study of genotype prevalence. (HuGE Navigator)
15475243 Single-nucleotide polymorphism in carboxylesterase 2 is associated with reduced mRNA expression in colorectal tumors
12960109 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12835618 The multiple promoters in the CES2 gene were characterized.

AA Sequence

MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGP      1 - 70
LRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNL     71 - 140
PVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQ    141 - 210
NIAHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSAC    211 - 280
DQVDSEALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLI    281 - 350
PKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA    351 - 420
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKY    421 - 490
WANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL     491 - 559
//

Text Mined References (61)

PMID Year Title
26025324 2015 Carboxylesterase 2 as a Determinant of Response to Irinotecan and Neoadjuvant FOLFIRINOX Therapy in Pancreatic Ductal Adenocarcinoma.
25724353 2015 Ontogenic expression of human carboxylesterase-2 and cytochrome P450 3A4 in liver and duodenum: postnatal surge and organ-dependent regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24212379 2014 Identification of carboxylesterase-dependent dabigatran etexilate hydrolysis.
24195516 2014 Relationship between the expression of CES2, UGT1A1, and GUSB in colorectal cancer tissues and aberrant methylation.
23480903 2013 Clinical implications of CES2 RNA expression in neuroblastoma.
23471941 2013 Relationship between CES2 genetic variations and rifampicin metabolism.
22525521 2012 Examination of the carboxylesterase phenotype in human liver.
21269460 2011 Initial characterization of the human central proteome.
20931200 2010 Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins.
20649590 2010 Biochemical and molecular analysis of carboxylesterase-mediated hydrolysis of cocaine and heroin.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20422440 2010 Mammalian carboxylesterase 3: comparative genomics and proteomics.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20195289 2010 Genetic variation in carboxylesterase genes and susceptibility to isoniazid-induced hepatotoxicity.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19856659 Decreased serum levels of carboxylesterase-2 in patients with ovarian cancer.
19508181 2009 Human carboxylesterases: an update on CES1, CES2 and CES3.
19349540 2009 Comprehensive pharmacogenetic analysis of irinotecan neutropenia and pharmacokinetics.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19274604 2009 Influence of carboxylesterase 2 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients.
19225040 2009 Different inhibitory effects in rat and human carboxylesterases.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18983829 2009 Human carboxylesterases HCE1 and HCE2: ontogenic expression, inter-individual variability and differential hydrolysis of oseltamivir, aspirin, deltamethrin and permethrin.
18797458 2008 Pharmacokinetic and pharmacogenetic determinants of the activity and toxicity of irinotecan in metastatic colorectal cancer patients.
18794728 2008 Structure and characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes.
18473752 2008 A carboxylesterase 2 gene polymorphism as predictor of capecitabine on response and time to progression.
18305377 2008 Structural organization and characterization of the regulatory element of the human carboxylesterase (CES1A1 and CES1A2) genes.
18259949 2008 Carboxylesterase 2 is downregulated in colorectal cancer following progression of the disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17764701 2007 Carboxylesterase in the liver and small intestine of experimental animals and human.
17640957 2007 Haplotypes and a novel defective allele of CES2 found in a Japanese population.
17537833 2007 Interleukin-6 alters the cellular responsiveness to clopidogrel, irinotecan, and oseltamivir by suppressing the expression of carboxylesterases HCE1 and HCE2.
17483951 2008 Functional study of the 830C>G polymorphism of the human carboxylesterase 2 gene.
16963839 2006 Transcriptional activation of the carboxylesterase 2 gene by the p53 pathway.
16690525 2006 Expression of ice, bcl-2, c-myc and p53 in different bone marrow cell populations from patients with diffuse large B-cell lymphoma.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15967118 2005 Altered expression of TFF-1 and CES-2 in Barrett's Esophagus and associated adenocarcinomas.
15618752 2003 Twelve novel single nucleotide polymorphisms in the CES2 gene encoding human carboxylesterase 2 (hCE-2).
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15592324 2004 Pharmacogenetics of human carboxylesterase 2, an enzyme involved in the activation of irinotecan into SN-38.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475733 2004 Determination and analysis of single nucleotide polymorphisms and haplotype structure of the human carboxylesterase 2 gene.
15475243 2004 Pharmacogenomic assessment of carboxylesterases 1 and 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12960109 2003 Irinotecan pathway genotype analysis to predict pharmacokinetics.
12835618 2003 Characterization of multiple promoters in the human carboxylesterase 2 gene.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10452915 1999 Human carboxylesterases in term placentae: enzymatic characterization, molecular cloning and evidence for the existence of multiple forms.
9169443 1997 Purification and cloning of a broad substrate specificity human liver carboxylesterase that catalyzes the hydrolysis of cocaine and heroin.
9144407 1997 Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.