Property Summary

NCBI Gene PubMed Count 9
PubMed Score 722.27
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung carcinoma 317 2.3e-30
lung carcinoma 2843 3.8e-20
lung adenocarcinoma 2716 7.3e-08
ovarian cancer 8520 1.7e-06
psoriasis 6694 6.1e-04
adult high grade glioma 3801 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Echinococcosis 26 5.818 2.9

Synonym

Accession Q9UKY3 A2RRL8 B9ZVS2
Symbols CES4
CESR
PCE-3
CES1A2
CES1A3

Gene

PANTHER Protein Class (1)

Gene RIF (4)

AA Sequence

MWLPALVLATLAASAAWAGHLSSPPLVDTLHGKVLGKFVSLEGFAQPVAVFLGIPFAKPPLGPLRFTLPQ      1 - 70
PAEPWNFVKNATSYPPMFTQDPKAGQLISELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWI     71 - 140
HGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSPGNWGHLDQLAALHWVQDNIASFG    141 - 210
GNPGSVTIFGGSVGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEVGLRLVRLRLDTP    211 - 280
TSLALCS                                                                   281 - 287
//

Text Mined References (11)

PMID Year Title