Property Summary

Ligand Count 165
NCBI Gene PubMed Count 95
PubMed Score 722.27
PubTator Score 500.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.600 9.2e-08
lung carcinoma -4.100 6.8e-45
non-small cell lung carcinoma -2.000 6.1e-31
psoriasis -1.600 9.8e-48

Protein-protein Interaction (8)

PDB (18)

Gene RIF (66)

AA Sequence

MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQP      1 - 70
AEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIH     71 - 140
GGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGG    141 - 210
NPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA    211 - 280
VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI    281 - 350
NKQEFGWLIPMQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL    351 - 420
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEI    421 - 490
RLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPP    491 - 560
QTEHIEL                                                                   561 - 567
//

Text Mined References (103)

PMID Year Title