Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.64
PubTator Score 16.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.0e-06
posterior fossa group B ependymoma 1530 1.5e-06
glioblastoma 5572 5.3e-04
pancreatic cancer 2300 1.2e-02
Disease Target Count Z-score Confidence
Plummer's disease 7 3.58 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma -1.500 1.5e-06
glioblastoma -1.100 5.3e-04
ovarian cancer 1.900 1.0e-06
pancreatic cancer 1.100 1.2e-02

Gene RIF (6)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
25779024 mRNA level of CerS5 is higher in cancerous cell lines and decreases following the induction of apoptosis.
20406683 Overexpression of CerS5 increased apoptosis in HeLa cells.
18676372 Down-regulation of either acid sphingomyelinase or LASS 5-attenuated ceramide accumulation and H/R-induced Bax translocation to mitochondria.
17030510 accumulation of C(16)-ceramide in mitochondria formed from the protein kinase C-dependent salvage pathway results at least in part from the action of longevity-assurance homologue 5, and the generated ceramide modulates the p38 cascade via PP1
16100120 study identifies LASS5 as a genuine dihydroceramide synthase and demonstrates that mammalian dihydroceramide synthases do not require additional subunits for their activity

AA Sequence

MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAK      1 - 70
PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTK     71 - 140
FCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIK    141 - 210
RKDFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVF    211 - 280
MVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRS    281 - 350
DVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE                                351 - 392
//

Text Mined References (16)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
25779024 2015 Linking the ceramide synthases (CerSs) 4 and 5 with apoptosis, endometrial and colon cancers.
22248339 2012 Ceramide synthases at the centre of sphingolipid metabolism and biology.
20406683 2010 Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells.
18676372 2008 Ceramide generated by sphingomyelin hydrolysis and the salvage pathway is involved in hypoxia/reoxygenation-induced Bax redistribution to mitochondria in NT-2 cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17030510 2006 Protein kinase C-induced activation of a ceramide/protein phosphatase 1 pathway leading to dephosphorylation of p38 MAPK.
16951403 2006 Necessary role for the Lag1p motif in (dihydro)ceramide synthase activity.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16100120 2005 LASS5 is a bona fide dihydroceramide synthase that selectively utilizes palmitoyl-CoA as acyl donor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12912983 2003 Two mammalian longevity assurance gene (LAG1) family members, trh1 and trh4, regulate dihydroceramide synthesis using different fatty acyl-CoA donors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12151215 2002 TRAM, LAG1 and CLN8: members of a novel family of lipid-sensing domains?