Property Summary

NCBI Gene PubMed Count 40
PubMed Score 68.17
PubTator Score 46.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.336 1.3e-03
osteosarcoma 1.178 3.9e-03
atypical teratoid / rhabdoid tumor 1.600 9.4e-08
glioblastoma 1.400 8.6e-05
pancreatic ductal adenocarcinoma liver m... -1.918 6.6e-04
breast carcinoma 1.400 4.1e-05
Breast cancer 1.100 1.3e-09
ductal carcinoma in situ 1.100 3.2e-02
invasive ductal carcinoma 1.300 3.1e-03
ovarian cancer 1.500 4.2e-04

Gene RIF (25)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
26150338 these results indicate that miR-9 upregulation might be associated with malignant phenotype of bladder cancer. miR-9 promotes chemoresistance of bladder cancer cells by target LASS2.
26110566 Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.
25973015 silencing of TMSG1 increased V-ATPase activity, decreased extracellular pH and in turn the activation of secreted MMP-2, which ultimately promoted metastasis capacity of breast cancer cell.
25735224 Results confirmed that TMSG1 is a potential metastasis suppressor gene, and suggested that the mechanism involved the induction of apoptosis and inhibition of cell proliferation via a caspase-dependent mitochondrial pathway.
25501280 the vacuolar ATPase (V-ATPase) activity and extracellular hydrogen ion concentration were significantly decreased and the activity of secreted matrix metalloproteinase-2 (MMP-2) was downregulated in MCF-7 cells overexpressing LASS2/TMSG1
25213553 Data show that CERS2 expression was markedly different between various breast cancer cells and inversely correlated with cell invasion.
24453046 the inhibitory effect of the LASS2 on growth, invasion and metastasis of prostate cancer cells
23690971 expression and role of ceramide synthase-2 in the lung
23538298 Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. we detected no effect on cell proliferation.
22991218 results contribute to the conclusion that LASS2/TMSG1 could regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase
22580606 LASS2 is involved in chemotherapeutic outcomes and low LASS2 expression may predict chemoresistance.
22573553 silencing of LASS2/TMSG1 can promote invasion of prostate cancer cell in vitro through increase of V-ATPase activity which accelerated tumor's invasion and metastasis, indicating that LASS2/TMSG1 is a novel tumor metastasis suppressor gene
22336162 There is a nucleolar localization signal within TMSG-1.
22190034 HIV-1 Vpu is identified to have a physical interaction with ceramide synthase 2 (CERS2; LASS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22178826 Silencing of LASS2 can promote invasion of prostate cancer cells in vitro through the increase of V-ATPase activity, extracellular hydrogen ion concentration and activation of secreted MMP-2.
22169644 KLF6 and Sp1 may participate in the inducible transcriptional regulation of TMSG-1 in prostate carcinoma cells.
21928351 Interaction of KLF6 and Sp1, together with their binding of elements in exon 1 are critical events in initiation of transcription of the tmsg-1 gene.
21755371 LASS2 expression may be correlated with the development and progression of human bladder carcinoma
20406683 Overexpression of CerS2 resulted in partial protection from ionizing radiation-induced apoptosis
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19912991 CerS2 and CerS6 mRNA was significantly elevated in breast cancer tissue compared to paired normal tissue, with approximately half of the individuals showing elevated CerS2 and CerS6 mRNA.
19728861 CerS2 down-regulation had a broad effect on ceramide homoeostasis, not just on very-long-chain ceramides.
18194600 TMSG-1 overexpression caused strong inhibition of proliferation and decreased clonogenicity of MDA-MB-231 cells, and promoted cell apoptosis.
18165233 activity of CerS2 can be regulated by another bioactive sphingolipid, sphingosine 1-phosphate

AA Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI      1 - 70
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF     71 - 140
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI    141 - 210
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL    211 - 280
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE    281 - 350
GEEAAAGGGAKSRPLANGHPILNNNHRKND                                            351 - 380
//

Text Mined References (50)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
26150338 2015 miR-9 promotes cell proliferation and inhibits apoptosis by targeting LASS2 in bladder cancer.
26110566 2015 AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.
25973015 2015 Silencing of TMSG1 enhances metastasis capacity by targeting V-ATPase in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25735224 2015 Overexpression of a Novel Tumor Metastasis Suppressor Gene TMSG1/LASS2 Induces Apoptosis via a Caspase-dependent Mitochondrial Pathway.
25501280 2015 LASS2/TMSG1 inhibits growth and invasion of breast cancer cell in vitro through regulation of vacuolar ATPase activity.
25213553 2015 CERS2 suppresses tumor cell invasion and is associated with decreased V-ATPase and MMP-2/MMP-9 activities in breast cancer.
24453046 2014 Silencing of LASS2/TMSG1 enhances invasion and metastasis capacity of prostate cancer cell.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23690971 2013 Ceramide synthases expression and role of ceramide synthase-2 in the lung: insight from human lung cells and mouse models.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23538298 2013 The equilibrium between long and very long chain ceramides is important for the fate of the cell and can be influenced by co-expression of CerS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22991218 2013 A novel tumor metastasis suppressor gene LASS2/TMSG1 interacts with vacuolar ATPase through its homeodomain.
22580606 2013 LASS2 enhances chemosensitivity of breast cancer by counteracting acidic tumor microenvironment through inhibiting activity of V-ATPase proton pump.
22573553 2012 Silencing of a novel tumor metastasis suppressor gene LASS2/TMSG1 promotes invasion of prostate cancer cell in vitro through increase of vacuolar ATPase activity.
22336162 2011 [Identification of nucleolar localization signal sequence of tumor metastasis suppressor gene-1].
22178826 2011 [Silencing of tumor metastasis suppressor gene 1 promotes invasion of prostate cancer cell in vitro and its molecular mechanisms].
22169644 2011 [Transcriptional activation of TMSG-1 by complex of KLF6 and Sp1].
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21928351 2012 KLF6/Sp1 initiates transcription of the tmsg-1 gene in human prostate carcinoma cells: an exon involved mechanism.
21755371 2012 Expression and prognostic significance of a new tumor metastasis suppressor gene LASS2 in human bladder carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20406683 2010 Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19912991 2010 Increased ceramide synthase 2 and 6 mRNA levels in breast cancer tissues and correlation with sphingosine kinase expression.
19728861 2009 Disruption of ceramide synthesis by CerS2 down-regulation leads to autophagy and the unfolded protein response.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18194600 2007 [Overexpression of tumor metastasis suppressor gene 1 suppresses proliferation and invasion, but enhances apoptosis of human breast cancer cells MDA-MB-231 cells].
18165233 2008 Characterization of ceramide synthase 2: tissue distribution, substrate specificity, and inhibition by sphingosine 1-phosphate.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543633 2001 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1.