Property Summary

Ligand Count 1
NCBI Gene PubMed Count 31
PubMed Score 79.42
PubTator Score 53.96

Knowledge Summary

Patent (4,306)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.547 2.1e-05
adult high grade glioma -1.100 3.1e-04
atypical teratoid / rhabdoid tumor -1.100 4.4e-04
glioblastoma -1.100 9.4e-05
intraductal papillary-mucinous neoplasm ... -1.400 1.8e-03
ovarian cancer -2.400 3.7e-09
primary pancreatic ductal adenocarcinoma -1.049 1.2e-02

Gene RIF (21)

AA Sequence

MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAVEETDVHGKHQ      1 - 70
GSGKWQKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPF     71 - 140
GGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGR    141 - 210
TQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTL    211 - 280
LRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAG    281 - 350
CFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDL    351 - 420
ILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSC    421 - 490
CCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS                           491 - 537
//

Text Mined References (34)

PMID Year Title