Property Summary

NCBI Gene PubMed Count 31
PubMed Score 75.43
PubTator Score 53.96

Knowledge Summary

Patent (4,306)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.4e-04
glioblastoma -1.100 9.4e-05
adrenocortical carcinoma -1.547 2.1e-05
primary pancreatic ductal adenocarcinoma -1.049 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.400 1.8e-03
adult high grade glioma -1.100 3.1e-04
ovarian cancer -2.400 3.7e-09

Protein-protein Interaction (1)

Gene RIF (21)

PMID Text
25164007 our findings identify a functional role for Cerk in breast cancer recurrence and suggest the clinical utility of agents targeted against this prosurvival pathway.
22579669 Data suggest that inhibition of ceramide kinase (CerK) [by specific gene silencing or pharmacological inhibition] drastically reduced cell proliferation in a neuroblastoma cell line.
22230689 TNF-alpha exposure of human SH-SY5Y neuroblastoma caused a profound increase in CERK activity.
21621503 Expression of hCERK enhanced ceramide-1-phosphate formation and release of arachidonic acid in Ca(2+) ionophore-stimulated cells.
21255156 We have identified a differential role for ceramide kinase in mast-cell activation
20877624 Observational study of gene-disease association. (HuGE Navigator)
19778898 JNK and ceramide kinase govern the biogenesis of lipid droplets through activation of group IVA phospholipase A2
19501188 The Pleckstrin Homology (PH) domain of CERK, which is required for Golgi complex localization, can substitute for the N-terminal region of CERKL and allow for wild-type CERKL localization, which is typified by nucleolar accumulation.
19125296 ceramide kinase, was associated with poor pathohistological grading in breast cancer
18662741 identification of a cluster of cysteines, C(347)XXXC(351)XXC(354), essential for CerK function
18156590 higher Ca2+ signal observed in hCERK transfected cells as well as the fact that CERK colocalized with EIgG during phagocytosis support hypothesis that Ca2+ signaling is an important factor for increasing phagocytosis and is regulated by CERK
17957442 HL-60 cells are useful for studying CerK functions in leukocyte differentiation, and they also suggest that CerK might have an important role in such differentiation.
17392267 Results demonstrate that CERK localizes to areas of eicosanoid synthesis and uses a ceramide "pool" transported in an active manner via CERT.
17274985 These results suggest that ceramide kinase determines the balance between pro-apoptotic ceramide and anti-apoptotic C1P to regulate cell fate, reminiscent of its function in plants.
16488390 CERK-pleckstrin homology domain plays a crucial role in plasma membrane targeting through its binding to phosphatidylinositol 4,5-bisphosphate and subsequent induction of ceramide-1-phosphate production in the vicinity of the membrane.
16269826 Recombinant CERK was analyzed with regard to dependence on divalent cations, to substrate delivery, specificity, and stereoselectivity. CERK associated with the plasma membrane in CHO cells, which is mediated by the N-terminal putative pleckstrin domain.
16170208 sphingoid chain was also required for substrate recognition by CERK
16081073 Pleckstrin homology domain of CERK is not only indispensable for its activity but also act as a regulator of CERK activity.
15899891 CERK translocates during activation from the cytosol to a lipid raft fraction
12855693 ceramide kinase and its product, C-1-P, have roles in arachidonic acid release and production of eicosanoids
11956206 Molecular cloning and functional characterization

AA Sequence

MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAVEETDVHGKHQ      1 - 70
GSGKWQKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPF     71 - 140
GGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGR    141 - 210
TQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTL    211 - 280
LRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAG    281 - 350
CFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDL    351 - 420
ILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSC    421 - 490
CCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS                           491 - 537
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25164007 2014 Ceramide kinase promotes tumor cell survival and mammary tumor recurrence.
22579669 2012 New signalling pathway involved in the anti-proliferative action of vitamin D? and its analogues in human neuroblastoma cells. A role for ceramide kinase.
22230689 2012 Ceramide kinase regulates TNF?-stimulated NADPH oxidase activity and eicosanoid biosynthesis in neuroblastoma cells.
21621503 2011 Role of cytosolic phospholipase A(2)? in cell rounding and cytotoxicity induced by ceramide-1-phosphate via ceramide kinase.
21255156 2011 A differential role for ceramide kinase in antigen/Fc?RI-mediated mast cell activation and function.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19899769 2010 Ceramide kinase profiling by mass spectrometry reveals a conserved phosphorylation pattern downstream of the catalytic site.
19778898 2009 JNK and ceramide kinase govern the biogenesis of lipid droplets through activation of group IVA phospholipase A2.
19501188 2009 Subcellular localization of ceramide kinase and ceramide kinase-like protein requires interplay of their Pleckstrin Homology domain-containing N-terminal regions together with C-terminal domains.
19168031 2009 A lipid binding domain in sphingosine kinase 2.
19125296 2009 Gene expression of ceramide kinase, galactosyl ceramide synthase and ganglioside GD3 synthase is associated with prognosis in breast cancer.
18662741 2008 A conserved cysteine motif essential for ceramide kinase function.
18156590 2008 Ceramide kinase promotes Ca2+ signaling near IgG-opsonized targets and enhances phagolysosomal fusion in COS-1 cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17957442 Ceramide kinase expression is altered during macrophage-like cell differentiation of the leukemia cell line HL-60.
17392267 2007 Ceramide kinase uses ceramide provided by ceramide transport protein: localization to organelles of eicosanoid synthesis.
17274985 2007 Ceramide kinase regulates growth and survival of A549 human lung adenocarcinoma cells.
16488390 2006 The interaction between the pleckstrin homology domain of ceramide kinase and phosphatidylinositol 4,5-bisphosphate regulates the plasma membrane targeting and ceramide 1-phosphate levels.
16269826 2006 Further characterization of mammalian ceramide kinase: substrate delivery and (stereo)specificity, tissue distribution, and subcellular localization studies.
16170208 2005 Substrate specificity of human ceramide kinase.
16081073 2005 The leucine 10 residue in the pleckstrin homology domain of ceramide kinase is crucial for its catalytic activity.
15899891 2005 Ceramide 1-phosphate, a mediator of phagocytosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14769792 2004 Ceramide kinase is a mediator of calcium-dependent degranulation in mast cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12855693 2003 Ceramide kinase mediates cytokine- and calcium ionophore-induced arachidonic acid release.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956206 2002 Ceramide kinase, a novel lipid kinase. Molecular cloning and functional characterization.
11258795 2001 Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping.
10947957 2000 Human sphingosine kinase: purification, molecular cloning and characterization of the native and recombinant enzymes.
10591208 1999 The DNA sequence of human chromosome 22.
9837889 1998 The formation of ceramide-1-phosphate during neutrophil phagocytosis and its role in liposome fusion.