Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.96
PubTator Score 2.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.1e-05
glioblastoma 1.400 3.2e-03
non-small cell lung cancer 1.055 7.4e-11
Pick disease -2.700 6.0e-06
progressive supranuclear palsy -2.400 7.2e-03
subependymal giant cell astrocytoma -1.417 3.6e-02

AA Sequence

MRAARAAPLLQLLLLLGPWLEAAGVAESPLPAVVLAILARNAEHSLPHYLGALERLDYPRARMALWCATD      1 - 70
HNVDNTTEMLQEWLAAVGDDYAAVVWRPEGEPRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADY     71 - 140
ILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTYYSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRV    141 - 210
PMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGL    211 - 280
EDERVNFIHLILEALVDGPRMQASAHVTRPSKRPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRV    281 - 350
VDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFE    351 - 420
SNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLAS    421 - 490
QPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSG    491 - 560
RLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL                                       561 - 595
//

Text Mined References (8)

PMID Year Title