Property Summary

NCBI Gene PubMed Count 20
PubMed Score 182.83
PubTator Score 30.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 9.8e-09
medulloblastoma, large-cell 6234 1.1e-04
Disease Target Count Z-score Confidence
Astigmatism 27 5.171 2.6
Myopia 99 3.648 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.1e-04
ovarian cancer 1.200 9.8e-09

Gene RIF (10)

PMID Text
26802359 Cerberus binds and inhibits Nodal, Activin B, BMP-6, and BMP-7 but not BMP-2 or Activin A.
24138842 No significant association between the studied DKK1 variations and osteoporosis was found, while CER1 variations seem to play a significant role in the determination of osteoporosis, combined with bone markers, in postmenopausal osteoporotic women.
23717584 results show that Cer1 (or CER1) serves as a good marker for quantification of definitive endoderm differentiation of mouse and human ES/iPS cells
22543871 CER1 gene variations play a significant role in determining BMD and vertebral or hip fractures, which might be helpful in clinical practice to identify patients with increased fracture risk
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19390575 Observational study of gene-disease association. (HuGE Navigator)
19113921 successful identification of an association with CER1 in humans together with our mouse study suggests that CER1 may play a role in the development of bone or its metabolism
19113921 Observational study of gene-disease association. (HuGE Navigator)
18452192 functional candidate gene for trigonocephaly

AA Sequence

MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVATSPAG      1 - 70
EGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFR     71 - 140
KTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCL    141 - 210
PAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVSA                 211 - 267
//

Text Mined References (20)

PMID Year Title
26802359 2016 New Ligand Binding Function of Human Cerberus and Role of Proteolytic Processing in Regulating Ligand-Receptor Interactions and Antagonist Activity.
24138842 2013 CER1 gene variations associated with bone mineral density, bone markers, and early menopause in postmenopausal women.
23717584 2013 Secreted cerberus1 as a marker for quantification of definitive endoderm differentiation of the pluripotent stem cells.
22543871 2012 Novel sequence variations in the CER1 gene are strongly associated with low bone mineral density and risk of osteoporotic fracture in postmenopausal women.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19113921 2009 Genome-wide haplotype association mapping in mice identifies a genetic variant in CER1 associated with BMD and fracture in southern Chinese women.
18452192 2008 Clinical and cytogenetic characterization of 13 Dutch patients with deletion 9p syndrome: Delineation of the critical region for a consensus phenotype.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17029022 2006 Bone morphogenetic proteins and their antagonists.
16798745 2006 Systemically administered bone morphogenetic protein-6 restores bone in aged ovariectomized rats by increasing bone formation and suppressing bone resorption.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10049596 1999 Human cerberus related gene CER1 maps to chromosome 9.
9660951 1998 The Xenopus dorsalizing factor Gremlin identifies a novel family of secreted proteins that antagonize BMP activities.
9501024 1998 Murine cerberus homologue mCer-1: a candidate anterior patterning molecule.