Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.32
PubTator Score 4.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 4.3e-03
malignant mesothelioma 1.900 4.5e-07
group 4 medulloblastoma 1.500 5.3e-06
medulloblastoma, large-cell 1.100 6.6e-05
primitive neuroectodermal tumor 1.100 4.2e-05
lung cancer 1.800 9.1e-04

 MGI Phenotype (1)

AA Sequence

MAVARVDAALPPGEGSVVNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRL      1 - 70
VRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIG     71 - 140
DLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMA    141 - 210
TPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTL    211 - 280
GLQTAEDAKLEKILSKQRFHQRQLMNQSQNEELSPLVPVETRASLIPEHSSPVQDCQISQESEPVIQVNS    281 - 350
WVGINSNDDQLFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLSPTVE    351 - 420
LRLQGINLGLEDDGVADESVKGLESQVLDKEEEQPLWAANENSVQMMRSEINTEVNEKAGLLPCPEPTII    421 - 490
SAILKDDNHSLTFFPESTEQKQSDIKKPENTQPENKETISQATSEKLPMILTQRSVALGQDKVALQKLND    491 - 560
AATKLQACWRGFYARNYNPQAKDVRYEIRLRRMQEHIVCLTDEIRRLRKERDEERIKKFVQEEAFRFLWN    561 - 630
QVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPD    631 - 700
SGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWNKESSNNEQDNS    701 - 770
LLEQYLTSVQQLEDADERTNFDTETRDSKLHIACFPVQLDTLSDGASVDESHGISPPLQGEISQTQENSK    771 - 840
LNAEVQGQQPECDSTFQLLHVGVTV                                                 841 - 865
//

Text Mined References (24)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22441691 2012 Neurl4, a novel daughter centriole protein, prevents formation of ectopic microtubule organizing centres.
22261722 2012 Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture.
21620453 2011 Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19460342 2009 Cep76, a centrosomal protein that specifically restrains centriole reduplication.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18694559 2008 CP110 suppresses primary cilia formation through its interaction with CEP290, a protein deficient in human ciliary disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18068367 2008 Double life of centrioles: CP110 in the spotlight.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17719545 2007 Cep97 and CP110 suppress a cilia assembly program.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.