Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.27
PubTator Score 2.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.8e-04
medulloblastoma, large-cell -1.300 3.5e-05
tuberculosis and treatment for 6 months 1.400 6.5e-06
intraductal papillary-mucinous adenoma (... 1.300 3.3e-03
diabetes mellitus -1.100 2.6e-02
Breast cancer -1.300 3.6e-07
pituitary cancer 1.400 3.9e-05

Gene RIF (4)

PMID Text
21938754 Detection of a novel imatinib-sensitive C6orf204-PDGFRB fusion in a patient with precursor T lymphoblastic lymphoma (T-ALL) and an associated myeloproliferative neoplasm with eosinophilia.
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MWGRFLAPEASGRDSPGGARSFPAGPDYSSAWLPANESLWQATTVPSNHRNNHIRRHSIASDSGDTGIGT      1 - 70
SCSDSVEDHSTSSGTLSFKPSQSLITLPTAHVMPSNSSASISKLRESLTPDGSKWSTSLMQTLGNHSRGE     71 - 140
QDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEKIGKAKALTSQLRTIGPSCLHDSMEM    141 - 210
LRLEDKEINKKRSSTLDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLML    211 - 280
GQQAVGGVPIQPSVRTQMWLTEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSY    281 - 350
SPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQP    351 - 420
QYENTSLQTPFSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSL    421 - 490
KKKCQKESEQNKEKQRRIETLEKYLADLPTLDDVQSQSLQLQILEEKNKNLQEALIDTEKKLEEIKKQCQ    491 - 560
DKETQLICQKKKEKELVTTVQSLQQKVERCLEDGIRLPMLDAKQLQNENDNLRQQNETASKIIDSQQDEI    561 - 630
DRMILEIQSMQGKLSKEKLTTQKMMEELEKKERNVQRLTKALLENQRQTDETCSLLDQGQEPDQSRQQTV    631 - 700
LSKRPLFDLTVIDQLFKEMSCCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSTETLT    701 - 770
KKLSDVCQLRRDIDELRTTISDRYAQDMGDNCITQ                                       771 - 805
//

Text Mined References (18)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
23463857 2013 Genome- and phenome-wide analyses of cardiac conduction identifies markers of arrhythmia risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22010048 2012 A genome-wide association study identifies a novel susceptibility locus for renal cell carcinoma on 12p11.23.
21938754 2012 Systematic screen for tyrosine kinase rearrangements identifies a novel C6orf204-PDGFRB fusion in a patient with recurrent T-ALL and an associated myeloproliferative neoplasm.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.