Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.27
PubTator Score 2.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.8e-04
Breast cancer -1.300 3.6e-07
diabetes mellitus -1.100 2.6e-02
intraductal papillary-mucinous adenoma (... 1.300 3.3e-03
medulloblastoma, large-cell -1.300 3.5e-05
pituitary cancer 1.400 3.9e-05
tuberculosis 1.100 1.3e-05

Gene RIF (4)

AA Sequence

MWGRFLAPEASGRDSPGGARSFPAGPDYSSAWLPANESLWQATTVPSNHRNNHIRRHSIASDSGDTGIGT      1 - 70
SCSDSVEDHSTSSGTLSFKPSQSLITLPTAHVMPSNSSASISKLRESLTPDGSKWSTSLMQTLGNHSRGE     71 - 140
QDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEKIGKAKALTSQLRTIGPSCLHDSMEM    141 - 210
LRLEDKEINKKRSSTLDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLML    211 - 280
GQQAVGGVPIQPSVRTQMWLTEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSY    281 - 350
SPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQP    351 - 420
QYENTSLQTPFSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSL    421 - 490
KKKCQKESEQNKEKQRRIETLEKYLADLPTLDDVQSQSLQLQILEEKNKNLQEALIDTEKKLEEIKKQCQ    491 - 560
DKETQLICQKKKEKELVTTVQSLQQKVERCLEDGIRLPMLDAKQLQNENDNLRQQNETASKIIDSQQDEI    561 - 630
DRMILEIQSMQGKLSKEKLTTQKMMEELEKKERNVQRLTKALLENQRQTDETCSLLDQGQEPDQSRQQTV    631 - 700
LSKRPLFDLTVIDQLFKEMSCCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSTETLT    701 - 770
KKLSDVCQLRRDIDELRTTISDRYAQDMGDNCITQ                                       771 - 805
//

Text Mined References (18)

PMID Year Title