Property Summary

NCBI Gene PubMed Count 23
PubMed Score 1268.07
PubTator Score 55.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.100 2.7e-07
sonic hedgehog group medulloblastoma 1.600 2.7e-07
cystic fibrosis 1.251 1.5e-04
medulloblastoma, large-cell -1.400 5.5e-03
colon cancer -1.200 5.8e-04
active ulcerative colitis -1.232 5.4e-03
interstitial cystitis -1.200 5.7e-03
posterior fossa group B ependymoma 1.100 1.8e-05
Endometriosis -1.016 2.4e-02
ovarian cancer 1.100 1.7e-05

Gene RIF (4)

PMID Text
26112604 findings suggest that Cep70 promotes microtubule stability by interaction with HDAC6 and regulation of tubulin acetylation
22427462 data showed that Cep70 increased the microtubule length without affecting the microtubule number in the purified system; results demonstrate that Cep70 could directly regulate microtubule assembly by promoting microtubule elongation instead of microtubule nucleation
21795687 These results thus report for the first time the identification of Cep70 as an important centrosomal protein that interacts with gamma-tubulin and underscore its critical role in the regulation of mitotic spindle assembly.
20734064 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNL      1 - 70
KLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQ     71 - 140
QNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLD    141 - 210
RQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEK    211 - 280
LNLQKDLETRPTQHELRLYKQQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQ    281 - 350
VLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAEL    351 - 420
VPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVPSLNGVYPRMN    421 - 490
EVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHE    491 - 560
EFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY                                     561 - 597
//

Text Mined References (24)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26112604 2015 Cep70 regulates microtubule stability by interacting with HDAC6.
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22427462 2012 Cep70 promotes microtubule assembly in vitro by increasing microtubule elongation.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21795687 2011 CEP70 protein interacts with ?-tubulin to localize at the centrosome and is critical for mitotic spindle assembly.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.