Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.50
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
interstitial lung disease 1.100 2.5e-03
astrocytic glioma 1.800 1.7e-02
oligodendroglioma 2.400 6.5e-03
psoriasis -1.200 3.8e-06
osteosarcoma -1.488 6.3e-04
atypical teratoid / rhabdoid tumor -1.500 1.4e-04
glioblastoma -1.100 4.7e-03
medulloblastoma, large-cell -1.100 4.2e-04
tuberculosis and treatment for 6 months 1.300 5.2e-04
intraductal papillary-mucinous carcinoma... -1.300 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.300 3.5e-02
lung cancer -1.200 2.1e-03
active ulcerative colitis -1.059 4.6e-02
breast carcinoma -1.500 2.9e-06
adult high grade glioma -1.100 1.3e-03
posterior fossa group B ependymoma -1.100 7.8e-05
subependymal giant cell astrocytoma -1.087 3.8e-02
Breast cancer -1.300 1.5e-14
Pick disease 1.100 2.5e-03
ductal carcinoma in situ -1.200 2.5e-04
invasive ductal carcinoma -1.500 1.3e-03
ovarian cancer -1.600 8.5e-06
cystic fibrosis and chronic rhinosinusit... 1.430 3.2e-03

Gene RIF (9)

PMID Text
25704143 C-terminal 300-400 amino acids of Cep68 are necessary to localize Cep68 to interphase centrosomes while C-terminal 400-500 amino acids might regulate Cep68 dissociation from centrosomes at mitotic onset.
25503564 Cep68 degradation allows Cep215 removal from peripheral pericentriolar material (PCM) preventing centriole separation following disengagement, PCNT cleavage mediates Cep215 removal from core of the PCM to inhibit centriole disengagement and duplication
24618698 CEP68 gene variants may play an important role in MNSAID-UA susceptibility and, despite the different regulatory mechanisms involved depending on the specific affected organ, in the development of hypersensitivity reactions to NSAIDs.
24554434 Centlein complexes with C-Nap1 and Cep68 at the proximal ends of centrioles during interphase.
21072201 Findings imply that CEP68 could be a susceptible gene for aspirin intolerance in asthmatics.
21072201 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of centrosomal protein 68kDa (CEP68) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18042621 data suggest that Cep68 cooperates with rootletin and C-Nap1 in centrosome cohesion.
17570516 our study is the first to identify and validate Endofin, DCBLD2, and KIAA0582 as part of a complex EGF phosphotyrosine signaling network

AA Sequence

MALGEEKAEAEASEDTKAQSYGRGSCRERELDIPGPMSGEQPPRLEAEGGLISPVWGAEGIPAPTCWIGT      1 - 70
DPGGPSRAHQPQASDANREPVAERSEPALSGLPPATMGSGDLLLSGESQVEKTKLSSSEEFPQTLSLPRT     71 - 140
TTICSGHDADTEDDPSLADLPQALDLSQQPHSSGLSCLSQWKSVLSPGSAAQPSSCSISASSTGSSLQGH    141 - 210
QERAEPRGGSLAKVSSSLEPVVPQEPSSVVGLGPRPQWSPQPVFSGGDASGLGRRRLSFQAEYWACVLPD    211 - 280
SLPPSPDRHSPLWNPNKEYEDLLDYTYPLRPGPQLPKHLDSRVPADPVLQDSGVDLDSFSVSPASTLKSP    281 - 350
TNVSPNCPPAEATALPFSGPREPSLKQWPSRVPQKQGGMGLASWSQLASTPRAPGSRDARWERREPALRG    351 - 420
AKDRLTIGKHLDMGSPQLRTRDRGWPSPRPEREKRTSQSARRPTCTESRWKSEEEVESDDEYLALPARLT    421 - 490
QVSSLVSYLGSISTLVTLPTGDIKGQSPLEVSDSDGPASFPSSSSQSQLPPGAALQGSGDPEGQNPCFLR    491 - 560
SFVRAHDSAGEGSLGSSQALGVSSGLLKTRPSLPARLDRWPFSDPDVEGQLPRKGGEQGKESLVQCVKTF    561 - 630
CCQLEELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDIDEHQSLTESVLQKGEILLQCLLENT    631 - 700
PVLEDVLGRIAKQSGELESHADRLYDSILASLDMLAGCTLIPDKKPMAAMEHPCEGV                 701 - 757
//

Text Mined References (21)

PMID Year Title
25704143 Cep68 can be regulated by Nek2 and SCF complex.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
25416956 2014 A proteome-scale map of the human interactome network.
24618698 2014 Variants of CEP68 gene are associated with acute urticaria/angioedema induced by multiple non-steroidal anti-inflammatory drugs.
24554434 2014 Centlein mediates an interaction between C-Nap1 and Cep68 to maintain centrosome cohesion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21072201 2010 Genome-wide and follow-up studies identify CEP68 gene variants associated with risk of aspirin-intolerant asthma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18042621 2007 Cep68 and Cep215 (Cdk5rap2) are required for centrosome cohesion.
17570516 2007 Phosphoproteomics identified Endofin, DCBLD2, and KIAA0582 as novel tyrosine phosphorylation targets of EGF signaling and Iressa in human cancer cells.
17194215 2007 Rate of evolution in brain-expressed genes in humans and other primates.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
9847074 1998 Toward a complete human genome sequence.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.