Property Summary

NCBI Gene PubMed Count 34
PubMed Score 40.86
PubTator Score 8.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3163 2.1e-06
osteosarcoma 7933 2.8e-06
ovarian cancer 8491 1.0e-03
psoriasis 6685 1.1e-03
Breast cancer 3098 2.7e-02
lung cancer 4473 4.6e-02
Disease Target Count Z-score Confidence
Intellectual disability 573 5.182 2.6
Disease Target Count Z-score Confidence
Seckel syndrome 35 5.139 2.6
Meier-Gorlin syndrome 12 3.144 1.6
Disease Target Count
Microcephaly 149
Seckel syndrome 6 1

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 2.1e-06
psoriasis -1.800 1.1e-03
osteosarcoma -1.473 2.8e-06
lung cancer 1.700 4.6e-02
Breast cancer 2.200 2.7e-02
ovarian cancer 1.300 1.0e-03

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26400686 CEP63 is particularly important for brain development and might control the proliferation and migration of cells when those two events need to be highly coordinated.
25643699 centrosomal Cdk1 signals were strongly diminished in cells treated with Cep63 siRNA when sc-54 was used for Cdk1 labeling
23936128 both mouse and human Cep63 and Cep152 cooperate to ensure efficient centriole duplication by promoting the accumulation of essential centriole duplication factors upstream of SAS-6 recruitment and procentriole formation.
23333316 Cep57, Cep63, and Cep152 are parts of a ring-like complex localizing around the proximal end of centrioles.
22555018 One new SNP (rs112926188) in CEP63O was reported. Analysis showed that rs112926188 allele substituting proline at the 61st residue position of CEP63 produced more flexibility in three-deimensional space.
21406398 Findings define Cep63 as a centrosomal recruitment factor for Cdk1 that is essential for mitotic entry, providing a physical link between the centrosome and the cell-cycle machinery.
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
16410684 CEP63 transcripts exhibited three different expression patterns, downregulation was found in about 50% of the cases analyzed and CEP63 gene transcription was associated with invasive tumors.

AA Sequence

MEALLEGIQNRGHGGGFLTSCEAELQELMKQIDIMVAHKKSEWEGRTHALETCLKIREQELKSLRSQLDV      1 - 70
THKEVGMLHQQVEEHEKIKQEMTMEYKQELKKLHEELCILKRSYEKLQKKQMREFRGNTKNHREDRSEIE     71 - 140
RLTAKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQSEIIQAQLVNRKQKLESVELSSQSEIQHLS    141 - 210
SKLERANDTICANELEIERLTMRVNDLVGTSMTVLQEQQQKEEKLRESEKLLEALQEEKRELKAALQSQE    211 - 280
NLIHEARIQKEKLQEKVKATNTQHAVEAIRPREESLAEKKYTSQGQGDLDSVLSQLNFTHTSEDLLQAEV    281 - 350
TCLEGSLESVSATCKQLSQELMEKYEELKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHL    351 - 420
TQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESLKLENRHLSEMVMKLELGLHEA    421 - 490
KEISLADLQENYIEALNKLVSENQQLQKDLMNTKSQLEISTQMCKKQNDRIFKPTHSRTTEFKNTEFKPT    491 - 560
HGQHRHDGIKTEHYKTDLHSPRGQASDSINPMSRVLSPLSPQISPCSSTRSLTSYSLCKTHSLPSALDTN    561 - 630
EANFSDTMSESMNDQEEFISSCSLPVSPLGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFT    631 - 700
ALK                                                                       701 - 703
//

Text Mined References (37)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26400686 2015 Mutation in CEP63 co-segregating with developmental dyslexia in a Swedish family.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25643699 2015 Cep63 recruits cdk1 to the centrosome-letter.
25416956 2014 A proteome-scale map of the human interactome network.
24613305 2014 Proximity interactions among centrosome components identify regulators of centriole duplication.
24240477 2013 The Cep63 paralogue Deup1 enables massive de novo centriole biogenesis for vertebrate multiciliogenesis.
23936128 2013 Cep63 and cep152 cooperate to ensure centriole duplication.
23333316 2013 Selective chemical crosslinking reveals a Cep57-Cep63-Cep152 centrosomal complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22555018 2012 Computational investigation of pathogenic nsSNPs in CEP63 protein.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21983783 2011 A primary microcephaly protein complex forms a ring around parental centrioles.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406398 2011 Cep63 recruits Cdk1 to the centrosome: implications for regulation of mitotic entry, centrosome amplification, and genome maintenance.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16410684 2005 The transcripts of SFRP1,CEP63 and EIF4G2 genes are frequently downregulated in transitional cell carcinomas of the bladder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.