Property Summary

NCBI Gene PubMed Count 33
PubMed Score 11.59
PubTator Score 12.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.304 5.4e-03
malignant mesothelioma 2.100 7.0e-08
psoriasis -1.800 1.9e-04
osteosarcoma -1.724 9.0e-07
group 3 medulloblastoma 1.700 2.8e-03
medulloblastoma, large-cell 1.100 6.9e-03
primitive neuroectodermal tumor 1.600 2.0e-04
tuberculosis and treatment for 6 months -1.200 6.5e-05
lung cancer 1.700 9.9e-04
pediatric high grade glioma 1.100 7.4e-03
atypical teratoid/rhabdoid tumor 1.100 4.4e-03
posterior fossa group B ependymoma 1.100 3.1e-03
progressive supranuclear palsy -1.100 7.7e-03
ovarian cancer 2.000 6.6e-05

Gene RIF (10)

PMID Text
26743940 Cep57 is a mitotic kinetochore component that links the function of the KMN (KNL1/Mis12 complex/Ndc80 complex) network and spindle assembly checkpoint via Mis12 binding and Mad1-Mad2 interaction.
26561035 We identified copy number variation (CNV) deletion impacting the exon sequences of CEP57L1, present in the affected mother and her affected daughter
23569207 Cep57 is essential for cytokinesis via regulation of central spindle assembly and formation of the midbody
23333316 Cep57, Cep63, and Cep152 are parts of a ring-like complex localizing around the proximal end of centrioles.
23243019 Data suggest for therapeutic targeting of the FGF-2/FGFR1/CEP57 axis in prostate cancer.
22508265 Cep57 acts as a PCM component through binding to NEDD1 and is required for spindle microtubule organization and maintenance of spindle pole integrity.
22190034 HIV-1 Vpu is identified to have a physical interaction with centrosomal protein 57kDa (CEP57) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21552266 Our findings indicate that these and/or additional functions of CEP57 are crucial for maintaining correct chromosomal number during cell division.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIF      1 - 70
SALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKC     71 - 140
NLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKM    141 - 210
QELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQP    211 - 280
HYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTP    281 - 350
PSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK    351 - 420
YQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNS    421 - 490
LQSSSLCWDY                                                                491 - 500
//

Text Mined References (37)

PMID Year Title
26743940 2016 Cep57 is a Mis12-interacting kinetochore protein involved in kinetochore targeting of Mad1-Mad2.
26561035 2015 Copy number variation in CEP57L1 predisposes to congenital absence of bilateral ACL and PCL ligaments.
25416956 2014 A proteome-scale map of the human interactome network.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23569207 2013 Cep57 protein is required for cytokinesis by facilitating central spindle microtubule organization.
23333316 2013 Selective chemical crosslinking reveals a Cep57-Cep63-Cep152 centrosomal complex.
23243019 2013 FGF-2 disrupts mitotic stability in prostate cancer through the intracellular trafficking protein CEP57.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22508265 2012 Cep57, a NEDD1-binding pericentriolar material component, is essential for spindle pole integrity.
22321063 2012 Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1.
21552266 2011 Mutations in CEP57 cause mosaic variegated aneuploidy syndrome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21306487 2011 Translokin (Cep57) interacts with cyclin D1 and prevents its nuclear accumulation in quiescent fibroblasts.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19804566 2009 Pivotal role of translokin/CEP57 in the unconventional secretion versus nuclear translocation of FGF2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12954732 2004 Tsp57: a novel gene induced during a specific stage of spermatogenesis.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12717444 2003 Translokin is an intracellular mediator of FGF-2 trafficking.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.