Property Summary

NCBI Gene PubMed Count 42
PubMed Score 32.70
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
esophageal adenocarcinoma 1.400 2.1e-02
psoriasis 1.900 1.9e-135
glioblastoma 4.200 2.3e-07
posterior fossa group A ependymoma 2.600 2.5e-09
group 3 medulloblastoma 4.200 3.0e-07
atypical teratoid / rhabdoid tumor 3.900 3.1e-11
medulloblastoma, large-cell 4.500 8.8e-08
primitive neuroectodermal tumor 3.800 3.9e-06
Atopic dermatitis 2.700 4.5e-06
adrenocortical carcinoma 2.817 1.9e-04
non-small cell lung cancer 3.477 6.7e-37
intraductal papillary-mucinous carcinoma... 2.900 2.5e-05
intraductal papillary-mucinous neoplasm ... 3.100 1.3e-03
colon cancer 2.100 8.6e-04
lung cancer 4.000 2.1e-06
active Crohn's disease 1.086 1.8e-02
pancreatic cancer 1.700 1.5e-06
breast carcinoma 1.800 6.4e-41
Breast cancer 3.600 2.2e-02
interstitial cystitis 1.400 9.6e-03
lung adenocarcinoma 1.800 4.0e-07
pediatric high grade glioma 3.800 2.9e-08
pilocytic astrocytoma 1.500 1.1e-05
non primary Sjogren syndrome sicca -1.300 2.2e-02
nasopharyngeal carcinoma 1.700 1.7e-04
Endometriosis 1.913 1.3e-02
ductal carcinoma in situ 2.700 8.1e-04
invasive ductal carcinoma 3.500 2.9e-05
ulcerative colitis 1.900 4.7e-06
ovarian cancer 3.100 1.0e-05

Gene RIF (21)

PMID Text
25915844 In depth discussion of the functions of CEP55 across different effector pathways, and also its roles as a biomarker and driver of tumorigenesis, commemorating a decade of research on CEP55. [review]
25889801 Which was required for FLJ10540/MMP-7 or FLJ10540/MMP-10 expressions.
25659891 myotubularin-related protein 3 and myotubularin-related protein 4 may act as a bridge between CEP55 and polo-like kinase 1, ensuring proper CEP55 phosphorylation and regulating CEP55 recruitment to the midbody.
25178936 CEP55 mRNA/protein expression was observed is specific to TCC of human urinary bladder and might be used as a diagnostic biomarker and vaccine target in development of BC specific immunotherapy.
24390615 cellular proliferation was suppressed as a result of cell cycle arrest at the G2/M phase in CEP55-knockdown cells
22771033 At the midbody, BRCA2 influences the recruitment of endosomal sorting complex required for transport (ESCRT)-associated proteins, Alix and Tsg101, and formation of CEP55-Alix and CEP55-Tsg101 complexes during abscission.
22591637 FLJ10540 may be critical regulator of disease progression in nasopharygeal carcinoma, and the underlying mechanism may involve in the osteopontin/CD44 pathway.
22184120 the existence of a p53-Plk1-Cep55 axis in which p53 negatively regulates expression of Cep55, through Plk1 which, in turn, is a positive regulator of Cep55 protein stability.
21079244 Data show that Plk1 activity negatively regulates Cep55 to ensure orderly abscission factor recruitment and ensures that this occurs only once cell contraction has completed.
20400365 Data provide strong evidence that CEP55 and HELLS may be used in conjunction with FOXM1 as a biomarker set for early cancer detection and indicators of malignant conversion and progression.
19855176 Cep55 is stabilized in a phosphorylation- and Pin1-dependent manner.
19609239 protein could be detected in breast- and lung carcinoma 9but not normal) tissues
19525975 FLJ10540 is not only an important prognostic factor but also a new therapeutic target in the FLJ10540/FOXM1/MMP-2 pathway for oral cavity squamous cell carcinoma treatment.
18948538 crystal structure of the ESCRT and ALIX-binding region (EABR) of CEP55 bound to an ALIX peptide at a resolution of 2.0 angstroms; structure shows that EABR forms an aberrant dimeric parallel coiled coil
18641129 the Cep55/Alix/ESCRT-III pathway has a role in cytokinesis and HIV-1 release
17853893 that ALIX and TSG101/ESCRT-I also bind a series of proteins involved in cytokinesis, including CEP55, CD2AP, ROCK1, and IQGAP1.
17556548 study shows that two proteins involved in HIV-1 budding-Tsg101, a subunit of the endosomal sorting complex required for transport I (ESCRT-I), & Alix, an ESCRT-associated protein-were recruited to the midbody during cytokinesis by interaction with Cep55
17237822 By forming a complex with phosphatidylinositol 3'-kinase, FLJ10540 activates the PI3-kinase/AKT proto-oncogene protein pathways, providing a mechanistic basis for FLJ10540-mediated oncogenesis.
16790497 This study defines a cellular mechanism that links centralspindlin to Cep55, which, in turn, controls the midbody structure and membrane fusion at the terminal stage of cytokinesis.
16406728 data suggest a possible involvement of CEP55 in centrosome-dependent cellular functions, such as centrosome duplication and/or cell cycle progression, or in the regulation of cytokinesis
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK      1 - 70
EKNAYQLTEKDKEIQRLRDQLKARYSTTTLLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA     71 - 140
ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE    141 - 210
TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN    211 - 280
QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA    281 - 350
LLEQQMQACTLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE    351 - 420
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK                              421 - 464
//

Text Mined References (51)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25915844 2016 Beyond cytokinesis: the emerging roles of CEP55 in tumorigenesis.
25889801 2015 Suppression of Aurora-A-FLJ10540 signaling axis prohibits the malignant state of head and neck cancer.
25659891 2015 Myotubularin-related proteins 3 and 4 interact with polo-like kinase 1 and centrosomal protein of 55 kDa to ensure proper abscission.
25449601 2015 Upregulation of FLJ10540, a PI3K-association protein, in rostral ventrolateral medulla impairs brain stem cardiovascular regulation during mevinphos intoxication.
25178936 2015 Expression and clinical significance of Centrosomal protein 55 (CEP55) in human urinary bladder transitional cell carcinoma.
24390615 2014 CEP55 contributes to human gastric carcinoma by regulating cell proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
22771033 2012 BRCA2 localization to the midbody by filamin A regulates cep55 signaling and completion of cytokinesis.
22591637 2012 FLJ10540 is associated with tumor progression in nasopharyngeal carcinomas and contributes to nasopharyngeal cell proliferation, and metastasis via osteopontin/CD44 pathway.
22184120 2012 Centrosomal protein 55 (Cep55) stability is negatively regulated by p53 protein through Polo-like kinase 1 (Plk1).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21310966 2011 Cortical constriction during abscission involves helices of ESCRT-III-dependent filaments.
21269460 2011 Initial characterization of the human central proteome.
21079244 2010 Plk1 negatively regulates Cep55 recruitment to the midbody to ensure orderly abscission.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20400365 2010 Downstream targets of FOXM1: CEP55 and HELLS are cancer progression markers of head and neck squamous cell carcinoma.
20186884 2010 Characterization of centrosomal proteins Cep55 and pericentrin in intercellular bridges of mouse testes.
20176808 2010 TEX14 interacts with CEP55 to block cell abscission.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19855176 2009 Cep55 stabilization is required for normal execution of cytokinesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638580 2009 The peptidyl-prolyl isomerase Pin1 regulates cytokinesis through Cep55.
19609239 2009 Cep55/c10orf3, a tumor antigen derived from a centrosome residing protein in breast carcinoma.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19525975 2009 Expression of FLJ10540 is correlated with aggressiveness of oral cavity squamous cell carcinoma by stimulating cell migration and invasion through increased FOXM1 and MMP-2 activity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18948538 2008 Midbody targeting of the ESCRT machinery by a noncanonical coiled coil in CEP55.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641129 2008 Differential requirements for Alix and ESCRT-III in cytokinesis and HIV-1 release.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
17556548 2007 Parallels between cytokinesis and retroviral budding: a role for the ESCRT machinery.
17237822 2007 FLJ10540-elicited cell transformation is through the activation of PI3-kinase/AKT pathway.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16790497 2006 Cep55, a microtubule-bundling protein, associates with centralspindlin to control the midbody integrity and cell abscission during cytokinesis.
16406728 2006 The novel centrosomal associated protein CEP55 is present in the spindle midzone and the midbody.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16198290 2005 Cdk1/Erk2- and Plk1-dependent phosphorylation of a centrosome protein, Cep55, is required for its recruitment to midbody and cytokinesis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.