Property Summary

NCBI Gene PubMed Count 29
PubMed Score 10.18
PubTator Score 11.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.300 4.0e-03
oligodendroglioma 1.100 3.7e-03
osteosarcoma 1.608 3.2e-03
primary pancreatic ductal adenocarcinoma -1.058 9.7e-03
group 3 medulloblastoma 1.200 2.2e-03
Pick disease 1.200 7.3e-05
ulcerative colitis 1.100 1.5e-06
ovarian cancer 2.400 1.1e-07
pituitary cancer -1.300 5.3e-04

 MGI Phenotype (1)

Gene RIF (10)

PMID Text
25340510 This study reveals a novel role for CEP164 in the pathogenesis of nephronophthisis, in which mutations cause ciliary defects coupled with DNA damage induced replicative stress, cell death, and epithelial-to-mesenchymal transition
25297623 Evidence is provided that TTBK2 effectively phosphorylate Cep164 and Cep97 and inhibits the interaction between Cep164 and its binding partner Dishevelled-3 (an important regulator of ciliogenesis) in a kinase activity-dependent manner.
24982133 data suggest that TTBK2 also acts upstream of Cep164, contributing to the assembly of distal appendages
23253480 Cep164 is targeted to the apical domain of the mother centriole to provide the molecular link between the mother centriole and the membrane biogenesis machinery that initiates cilia formation.
23150559 findings indicate that ARL13B, INPP5E, PDE6D, and CEP164 form a distinct functional network that is involved in JBTS and NPHP but independent of the ones previously defined by NPHP and MKS proteins
22863007 Study identifies by whole-exome resequencing, mutations of MRE11, ZNF423, and CEP164 as causing Nephronophthisis-related ciliopathies.
22004425 Single nucleotide polymorphisms of CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2 genes were significantly associated with development and recurrence of hepatocellular carcinoma in Japanese patients with hepatitis C virus.
19197159 Results show that Cep164 knockdown compromises the cell survival upon UV damage, and that UV irradiation significantly enhances the interaction between Cep164 and XPA.
18283122 Cep164 is a key player in the DNA damage-activated signaling cascade.
17954613 These data implicate distal appendages in primary cilia formation and identify Cep164 as an excellent marker for these structures.

AA Sequence

MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITG      1 - 70
DIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKKKKKKEKKDKKDRDPPKSSLALGSSLAPV     71 - 140
HVPLGGLAPLRGLVDTPPSALRGSQSVSLGSSVESGRQLGELMLPSQGLKTSAYTKGLLGSIYEDKTALS    141 - 210
LLGLGEETNEEDEEESDNQSVHSSSEPLRNLHLDIGALGGDFEYEESLRTSQPEEKKDVSLDSDAAGPPT    211 - 280
PCKPSSPGADSSLSSAVGKGRQGSGARPGLPEKEENEKSEPKICRNLVTPKADPTGSEPAKASEKEAPED    281 - 350
TVDAGEEGSRREEAAKEPKKKASALEEGSSDASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRIS    351 - 420
EHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHEERAQSPPRSLAT    421 - 490
EEEPPQGPEGQPEWKEAEELGEDSAASLSLQLSLQREQAPSPPAACEKGKEQHSQAEELGPGQEEAEDPE    491 - 560
EKVAVSPTPPVSPEVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEE    561 - 630
EEILRLHQQKEQSLSSLRERLQKAIEEEEARMREEESQRLSWLRAQVQSSTQADEDQIRAEQEASLQKLR    631 - 700
EELESQQKAERASLEQKNRQMLEQLKEEIEASEKSEQAALNAAKEKALQQLREQLEGERKEAVATLEKEH    701 - 770
SAELERLCSSLEAKHREVVSSLQKKIQEAQQKEEAQLQKCLGQVEHRVHQKSYHVAGYEHELSSLLREKR    771 - 840
QEVEGEHERRLDKMKEEHQQVMAKAREQYEAEERKQRAELLGHLTGELERLQRAHERELETVRQEQHKRL    841 - 910
EDLRRRHREQERKLQDLELDLETRAKDVKARLALLEVQEETARREKQQLLDVQRQVALKSEEATATHQQL    911 - 980
EEAQKEHTHLLQSNQQLREILDELQARKLKLESQVDLLQAQSQQLQKHFSSLEAEAQKKQHLLREVTVEE    981 - 1050
NNASPHFEPDLHIEDLRKSLGTNQTKEVSSSLSQSKEDLYLDSLSSHNVWHLLSAEGVALRSAKEFLVQQ   1051 - 1120
TRSMRRRQTALKAAQQHWRHELASAQEVAKDPPGIKALEDMRKNLEKETRHLDEMKSAMRKGHNLLKKKE   1121 - 1190
EKLNQLESSLWEEASDEGTLGGSPTKKAVTFDLSDMDSLSSESSESFSPPHREWWRQQRIDSTPSLTSRK   1191 - 1260
IHGLSHSLRQISSQLSSVLSILDSLNPQSPPPLLASMPAQLPPRDPKSTPTPTYYGSLARFSALSSATPT   1261 - 1330
STQWAWDSGQGPRLPSSVAQTVDDFLLEKWRKYFPSGIPLLSNSPTPLESRLGYMSASEQLRLLQHSHSQ   1331 - 1400
VPEAGSTTFQGIIEANRRWLERVKNDPRLPLFSSTPKPKATLSLLQLGLDEHNRVKVYRF             1401 - 1460
//

Text Mined References (32)

PMID Year Title
26337392 2015 MDM1 is a microtubule-binding protein that negatively regulates centriole duplication.
25340510 2014 Nephronophthisis-associated CEP164 regulates cell cycle progression, apoptosis and epithelial-to-mesenchymal transition.
25297623 2014 Binding to Cep164, but not EB1, is essential for centriolar localization of TTBK2 and its function in ciliogenesis.
24982133 2014 Cep164 triggers ciliogenesis by recruiting Tau tubulin kinase 2 to the mother centriole.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23530209 2013 CCDC41 is required for ciliary vesicle docking to the mother centriole.
23348840 2013 Centriole distal appendages promote membrane docking, leading to cilia initiation.
23253480 2012 Cep164 mediates vesicular docking to the mother centriole during early steps of ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23150559 2012 ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22004425 2012 Genetic risk of hepatocellular carcinoma in patients with hepatitis C virus: a case control study.
21976302 2011 Assessing the localization of centrosomal proteins by PALM/STORM nanoscopy.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
19197159 2009 UV-dependent interaction between Cep164 and XPA mediates localization of Cep164 at sites of DNA damage and UV sensitivity.
18283122 2008 Cep164 is a mediator protein required for the maintenance of genomic stability through modulation of MDC1, RPA, and CHK1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17954613 2007 Cep164, a novel centriole appendage protein required for primary cilium formation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16052032 2005 Assigning functions to genes: identification of S-phase expressed genes in Leishmania major based on post-transcriptional control elements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.