Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.21
PubTator Score 14.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -2.500 1.1e-05
glioblastoma 1.600 2.5e-07
osteosarcoma -1.545 1.0e-02
posterior fossa group B ependymoma 1.700 9.6e-09
group 3 medulloblastoma 2.300 2.1e-05
atypical teratoid/rhabdoid tumor 1.400 3.2e-07
primitive neuroectodermal tumor 1.300 2.3e-03
tuberculosis and treatment for 6 months 1.400 3.1e-05
pediatric high grade glioma 1.200 5.8e-05
pilocytic astrocytoma 1.100 1.7e-05
non primary Sjogren syndrome sicca -1.200 2.0e-02
nasopharyngeal carcinoma 1.300 6.1e-05
spina bifida -1.749 3.6e-02
ulcerative colitis 1.300 2.0e-08
ovarian cancer 1.200 1.6e-02

Gene RIF (5)

PMID Text
26412126 Authors suggest that the decrease in CEP135(mini) from centrosomes promotes centriole assembly. The repression of centriole duplication by a splice isoform of a protein that normally promotes it serves as a novel mechanism to limit centriole duplication.
25086031 These findings support a model in which PKC-mediated phosphorylation of CEP4 at Ser(18) and Ser(80) causes its dissociation from Cdc42, thereby increasing its affinity for TEM4 and producing Rac activation, filopodium formation, and cell motility
23511974 Authors propose that CEP135 directly connects the central hub protein, hSAS-6, to the outer microtubules, and suggest that this interaction stabilizes the proper cartwheel structure for further CPAP-mediated centriole elongation.
22521416 A truncating mutation of CEP135 caused autosomal-recessive primary microcephaly in a Pakistani family.
18851962 CEP135 acts as a platform protein for C-NAP1 at the centriole.

AA Sequence

MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEP      1 - 70
YKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNE     71 - 140
RIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQ    141 - 210
QEVHQLQEKLAMMESGVRDYSKQIELREREIERLSVALDGGRSPDVLSLESRNKTNEKLIAHLNIQVDFL    211 - 280
QQANKDLEKRIRELMETKETVTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKE    281 - 350
IKRKLSEMQDLEETMAKLQLELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFAVTERQL    351 - 420
TLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTSYSAREKSSIFRTPE    421 - 490
KGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTAERDKLSVLYNEAQEELSALRKESTQTTAP    491 - 560
HNIVSLMEKEKELALSDLRRIMAEKEALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSK    561 - 630
VLIMKETIESLENKLKVQAQKFSHVAGDSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELESAQAQ    631 - 700
IKILEEKIDELNLKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQMKIM    701 - 770
ISECESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATMARENQEISLE    771 - 840
LEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQAEGESSSVRLE    841 - 910
LLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEELRHQEDEKATVLNDLSSLREL    911 - 980
CIKLDSGKDIMTQQLNSKNLEFERVVVELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHLT    981 - 1050
SHEKDTEIQLLKEKLTLSESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGLA   1051 - 1120
TPPLSSTLRSPSHSPEHRNV                                                     1121 - 1140
//

Text Mined References (29)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26675238 2016 WDR8 is a centriolar satellite and centriole-associated protein that promotes ciliary vesicle docking during ciliogenesis.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26545777 2015 The conserved Wdr8-hMsd1/SSX2IP complex localises to the centrosome and ensures proper spindle length and orientation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26412126 2015 A Short CEP135 Splice Isoform Controls Centriole Duplication.
25086031 2014 Phosphorylation of Cdc42 effector protein-4 (CEP4) by protein kinase C promotes motility of human breast cells.
23511974 2013 Human microcephaly protein CEP135 binds to hSAS-6 and CPAP, and is required for centriole assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22521416 2012 A truncating mutation of CEP135 causes primary microcephaly and disturbed centrosomal function.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20531387 2010 PLK2 phosphorylation is critical for CPAP function in procentriole formation during the centrosome cycle.
18851962 2008 A novel function of CEP135 as a platform protein of C-NAP1 for its centriolar localization.
17681131 2007 Plk4-induced centriole biogenesis in human cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.