Property Summary

NCBI Gene PubMed Count 31
PubMed Score 15.62
PubTator Score 13.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
glioblastoma 1.200 2.8e-04
group 3 medulloblastoma 3.200 4.0e-05
atypical teratoid/rhabdoid tumor 1.600 1.3e-06
medulloblastoma, large-cell 1.400 6.2e-03
primitive neuroectodermal tumor 1.200 1.4e-02
adrenocortical carcinoma 2.039 7.3e-05
non-small cell lung cancer 2.182 1.7e-18
intraductal papillary-mucinous carcinoma... 1.500 6.9e-04
intraductal papillary-mucinous neoplasm ... 2.100 7.5e-04
interstitial cystitis 1.500 9.7e-04
pediatric high grade glioma 1.200 2.1e-03
psoriasis 1.400 2.7e-12
lung adenocarcinoma 1.400 4.5e-06
Endometriosis 1.356 2.5e-02
ductal carcinoma in situ 1.200 1.9e-02
ulcerative colitis 1.700 5.4e-06
ovarian cancer 1.600 2.3e-05
Breast cancer 2.400 3.3e-07
pituitary cancer 1.200 5.2e-04

 GO Function (1)

Gene RIF (19)

PMID Text
26881882 CENP-W interacts with hnRNPU and may contribute to kinetochore-microtubule attachment in mitotic cells.
26111449 CENP-W is a novel kinetochore component that may be involved in the EZH2-mediated silencing machinery.
25329824 We propose that CENP-W, by influencing proper kinetochore assembly, particularly microtubule docking sites, can confer spindle pole resistance to traction forces exerted by motor proteins during chromosome congression
24452380 CUG2-mediated antiviral activity can be reduced by ISG15 deficiency in A549 cells, which eventually enhances sensitivity of the cells to vesicular stomatitis virus infection.
23926101 CSN5 regulates the stability of the inner kinetochore components CENP-T and CENP-W, providing the first direct link between CSN5 and the mitotic apparatus, highlighting the role of CSN5 as a multifunctional cell cycle regulator.
23917355 our results suggest that CUG2 enhances metastasis and drug resistance through STAT1 activation, which eventually contributes to tumor progression
23306614 we propose that VSV treatment combined with the selective regulation of genes such as STAT1 and OASL2 will improve therapeutic outcomes for CUG2-overexpressing tumors.
22131368 Single nucleotide polymorphism in CENPW is associated with the length of reproductive lifespan.
22002061 B23 may function in the assembly of the kinetochore complex by interacting with CENP-W during interphase
21695110 The CENP-T/W complex assembles through a dynamic exchange mechanism in late S-phase and G2, is required for mitosis in each cell cycle and does not persist across cell generations.
20846217 Observational study of gene-disease association. (HuGE Navigator)
20648695 Overexpression of CUG2 induces apoptosis in SKOV-3 cells.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20180024 Sp1 together with Sp3 may function as the main regulator of the basal and serum-induced transcription of CENP-W.
20075984 data indicate that activation of p38 MAPK and Ras has critical roles in reoviral replication in CUG2-expressing tumor cells.
19533040 CUG2 is a new component of the human centromeric complex that is required for proper chromosome segregation during mitosis.
19266077 Observational study of gene-disease association. (HuGE Navigator)
19070575 Study demonstrates that CENP-W forms a DNA-binding complex together with the CCAN component CENP-T; this complex directly associates with nucleosomal DNA and with canonical histone H3, but not with CENP-A, in centromeric regions.
17610844 These findings suggest CUG2 is a novel tumor-associated gene that is commonly activated in various human cancers and exhibits high transforming activities; it possibly belongs to a transcription regulator family that is involved in tumor biogenesis.

AA Sequence

MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVI      1 - 70
NKEHVLAAAKVILKKSRG                                                         71 - 88
//

Text Mined References (35)

PMID Year Title
26881882 2016 Centromere Protein (CENP)-W Interacts with Heterogeneous Nuclear Ribonucleoprotein (hnRNP) U and May Contribute to Kinetochore-Microtubule Attachment in Mitotic Cells.
26111449 2015 A new kinetochore component CENP-W interacts with the polycomb-group protein EZH2 to promote gene silencing.
25329824 2014 CENP-W plays a role in maintaining bipolar spindle structure.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24452380 2014 Suppression of autophagic genes sensitizes CUG2-overexpressing A549 human lung cancer cells to oncolytic vesicular stomatitis virus-induced apoptosis.
23926101 2013 CSN5/JAB1 interacts with the centromeric components CENP-T and CENP-W and regulates their proteasome-mediated degradation.
23917355 2013 Cancer upregulated gene 2, a novel oncogene, enhances migration and drug resistance of colon cancer cells via STAT1 activation.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23306614 2013 Cancer upregulated gene 2, a novel oncogene, confers resistance to oncolytic vesicular stomatitis virus through STAT1-OASL2 signaling.
22504418 2012 Common variants at 6q22 and 17q21 are associated with intracranial volume.
22304917 2012 CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold.
22131368 2012 Replication of loci influencing ages at menarche and menopause in Hispanic women: the Women's Health Initiative SHARe Study.
22002061 2011 New centromeric component CENP-W is an RNA-associated nuclear matrix protein that interacts with nucleophosmin/B23 protein.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21695110 2011 Premitotic assembly of human CENPs -T and -W switches centromeric chromatin to a mitotic state.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20648695 2010 Cancer-upregulated gene 2 (CUG2) overexpression induces apoptosis in SKOV-3 cells.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20180024 2010 Sp1 and Sp3 mediate basal and serum-induced expression of human CENP-W.
20075984 2010 CUG2, a novel oncogene confers reoviral replication through Ras and p38 signaling pathway.
19533040 2009 Cancer-upregulated gene 2 (CUG2), a new component of centromere complex, is required for kinetochore function.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19070575 2008 CCAN makes multiple contacts with centromeric DNA to provide distinct pathways to the outer kinetochore.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17610844 2007 Molecular cloning and functional analysis of a novel oncogene, cancer-upregulated gene 2 (CUG2).
17079448 2006 Genetic reclassification of histologic grade delineates new clinical subtypes of breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.