Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.50
PubTator Score 13.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 5.1e-12
Pick disease 1893 1.1e-06
psoriasis 6685 2.3e-05

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.200 2.3e-05
osteosarcoma -2.693 5.1e-12
Pick disease -1.600 1.1e-06

 GO Function (1)

Gene RIF (8)

PMID Text
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25660545 CENP-T directly interacts with Ndc80, which in turn promotes KNL1/Mis12 complex recruitment at kinetochores during chromosome segregation.
23926101 CSN5 regulates the stability of the inner kinetochore components CENP-T and CENP-W, providing the first direct link between CSN5 and the mitotic apparatus, highlighting the role of CSN5 as a multifunctional cell cycle regulator.
23334297 CENP-T provides a structural platform for outer kinetochore assembly.
22561346 results reveal the molecular function of CENP-T proteins and demonstrate how the Ndc80 complex is anchored to centromeres in a manner that couples chromosome movement to spindle dynamics
21695110 The CENP-T/W complex assembles through a dynamic exchange mechanism in late S-phase and G2, is required for mitosis in each cell cycle and does not persist across cell generations.
19412974 CENP-T exchange into centromeres is restricted to the S-phase of the cell cycle as revealed by FRAP, suggesting a coreplicational loading mechanism.
19070575 Study demonstrates that CENP-W forms a DNA-binding complex together with the CCAN component CENP-T; this complex directly associates with nucleosomal DNA and with canonical histone H3, but not with CENP-A, in centromeric regions.

AA Sequence

MADHNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASPRKLSGQTRTIARGRSHGARSVG      1 - 70
RSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPP     71 - 140
TTLAPGLLAPGRRKQRLRLSVFQQGVDQGLSLSQEPQGNADASSLTRSLNLTFATPLQPQSVQRPGLARR    141 - 210
PPARRAVDVGAFLRDLRDTSLAPPNIVLEDTQPFSQPMVGSPNVYHSLPCTPHTGAEDAEQAAGRKTQSS    211 - 280
GPGLQKNSPGKPAQFLAGEAEEVNAFALGFLSTSSGVSGEDEVEPLHDGVEEAEKKMEEEGVSVSEMEAT    281 - 350
GAQGPSRVEEAEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEPA    351 - 420
PAPGAAVLSSEPAEPLLVRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCLDKY    421 - 490
FQHLCDDLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQLLIPCAYSGNSVFPA    491 - 560
Q//

Text Mined References (28)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25660545 2015 Distinct organization and regulation of the outer kinetochore KMN network downstream of CENP-C and CENP-T.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23926101 2013 CSN5/JAB1 interacts with the centromeric components CENP-T and CENP-W and regulates their proteasome-mediated degradation.
23334297 2013 CENP-T provides a structural platform for outer kinetochore assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22561346 2012 CENP-T proteins are conserved centromere receptors of the Ndc80 complex.
22304917 2012 CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold.
21695110 2011 Premitotic assembly of human CENPs -T and -W switches centromeric chromatin to a mitotic state.
21529714 2011 Induced ectopic kinetochore assembly bypasses the requirement for CENP-A nucleosomes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19533040 2009 Cancer-upregulated gene 2 (CUG2), a new component of centromere complex, is required for kinetochore function.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19412974 2008 Live-cell imaging reveals sustained centromere binding of CENP-T via CENP-A and CENP-B.
19070575 2008 CCAN makes multiple contacts with centromeric DNA to provide distinct pathways to the outer kinetochore.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.