Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.25
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.5e-04
cystic fibrosis 1.085 5.4e-04
ependymoma 1.100 8.7e-05
glioblastoma 1.500 4.1e-07
group 3 medulloblastoma 1.400 6.2e-03
hepatocellular carcinoma 1.200 4.0e-04
lung cancer 1.400 1.7e-03
malignant mesothelioma 1.900 5.2e-07
pediatric high grade glioma 1.400 1.7e-05
primitive neuroectodermal tumor 1.300 1.8e-03
tuberculosis and treatment for 6 months -1.300 5.1e-04

Gene RIF (4)

AA Sequence

MSGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKR      1 - 70
KTWQPLSKSTRDHLQTMMESVIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSL     71 - 140
LNMERARDKANEEGLALLQEEIDKMVETTELMTGNIQSLKNKIQILASEVEEEEERVKQMHQINSSGVLS    141 - 210
LPELSQKTLKAPTLQKEILALIPNQNALLKDLDILHNSSQMKSMSTFIEEAYKKLDAS                211 - 268
//

Text Mined References (13)

PMID Year Title