Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.96
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (3)

PMID Text
26698661 Study demonstrate that the CENP-L-N complex plays a crucial role at the core of the 16-subunit Constitutive Centromere-Associated Network through interactions with CENP-C and CENP-H-I-KM.
22100916 CENP-N is bound to kinetochores during S phase and G2, but is absent from kinetochores during mitosis and G1.
19543270 Data suggest that CENP-N interprets the information encoded within CENP-A nucleosomes and recruits other proteins to centromeric chromatin that are required for centromere function and propagation.

AA Sequence

MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD      1 - 70
IIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQ     71 - 140
YTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYN    141 - 210
QTFETHNSTTPLQERSLGLDINMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLN    211 - 280
GSILAEREEPLRCLIKFSSPHLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK               281 - 339
//

Text Mined References (20)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26698661 2015 The CENP-L-N Complex Forms a Critical Node in an Integrated Meshwork of Interactions at the Centromere-Kinetochore Interface.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22426531 2012 A conserved role for COMA/CENP-H/I/N kinetochore proteins in the spindle checkpoint.
22100916 2011 Dynamics of CENP-N kinetochore binding during the cell cycle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19543270 2009 Centromere assembly requires the direct recognition of CENP-A nucleosomes by CENP-N.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18007590 2007 The CENP-A NAC/CAD kinetochore complex controls chromosome congression and spindle bipolarity.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.