Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.78
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (5)

PMID Text
25006165 CENP-M is crucially required for the assembly and stability of a tetramer also comprising CENP-I, CENP-H, and CENP-K, the HIKM complex, which we extensively characterize through a combination of structural, biochemical, and cell biological approaches.
19773279 Observational study of gene-disease association. (HuGE Navigator)
16622419 PANE1 localizes to the centromere throughout the cell cycle and its localization is dependent on the centromere specific histone variant CENP-A.
16391015 an alternative transcript of the proliferation-associated nuclear element 1 (PANE1) gene encodes a novel (HLA)-A(*)0301-restricted mHAg that is selectively expressed in B-lymphoid cells
15183305 Expression of the human PANE1 gene was detected preferentially in immune cells

AA Sequence

MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV      1 - 70
NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA     71 - 140
TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL                                  141 - 180
//

Text Mined References (19)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25006165 2014 The pseudo GTPase CENP-M drives human kinetochore assembly.
24553122 2014 Acquired resistance to metformin in breast cancer cells triggers transcriptome reprogramming toward a degradome-related metastatic stem-like profile.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
21269460 2011 Initial characterization of the human central proteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19533115 2009 Acceptor-photobleaching FRET analysis of core kinetochore and NAC proteins in living human cells.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
16391015 2006 The PANE1 gene encodes a novel human minor histocompatibility antigen that is selectively expressed in B-lymphoid cells and B-CLL.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15183305 2004 The proliferation associated nuclear element (PANE1) is conserved between mammals and fish and preferentially expressed in activated lymphoid cells.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.