Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.56
PubTator Score 9.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.400 1.4e-06
glioblastoma 1.100 3.1e-04
group 3 medulloblastoma 2.200 3.4e-05
atypical teratoid/rhabdoid tumor 1.400 4.4e-07
medulloblastoma, large-cell 1.300 1.2e-03
adrenocortical carcinoma 1.211 1.2e-02
non-small cell lung cancer 1.473 2.3e-16
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-03
colon cancer 1.800 4.7e-02
lung cancer 1.800 1.2e-04
lung adenocarcinoma 1.300 5.0e-08
Breast cancer 1.400 2.1e-10
psoriasis 1.200 9.3e-60

Gene RIF (6)

PMID Text
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
25525168 mutation in LRPAP1 is associated with high myopia. Further studies are expected to evaluate the pathogenicity of the variants in CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2.
24862574 We conclude that the dual activities of Aurora B and CENP-I generate a molecular switch that maintains a robust spindle checkpoint signal at prometaphase kinetochores until they attain mature attachments to microtubules.
21888900 demonstrates that CENPI, a centromere protein that localizes to the inner kinetochore structure, is a human autoantigen. The significance of anti-CENPI autoantibodies could be relevant in scleroderma patients as a marker for autoimmune liver disease
18045986 the vertebrate KNL1 counterpart is essential for chromosome segregation and is required to localize a subset of outer kinetochore proteins.
16622420 The CENP-H-I complex may function, in part, as a marker directing CENP-A deposition to centromeres.

AA Sequence

MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAV      1 - 70
GYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVIS     71 - 140
EDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTK    141 - 210
KENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRN    211 - 280
RGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQL    281 - 350
LQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDT    351 - 420
IIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFK    421 - 490
CSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHF    491 - 560
ILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEF    561 - 630
NFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQES    631 - 700
PEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY                  701 - 756
//

Text Mined References (20)

PMID Year Title
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
25525168 2014 Detection of mutations in LRPAP1, CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2 in 298 families with early-onset high myopia by exome sequencing.
24862574 2014 CENP-I and Aurora B act as a molecular switch that ties RZZ/Mad1 recruitment to kinetochore attachment status.
21888900 2011 Anti-CENPI autoantibodies in scleroderma patients with features of autoimmune liver diseases.
20212317 2010 The SUMO protease SENP6 is essential for inner kinetochore assembly.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18045986 2008 KNL1 and the CENP-H/I/K complex coordinately direct kinetochore assembly in vertebrates.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
12640463 2003 Human CENP-I specifies localization of CENP-F, MAD1 and MAD2 to kinetochores and is essential for mitosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8921378 1996 Sequence and chromosomal location of a human homologue of LRPR1, an FSH primary response gene.
7758824 1995 Regulation of gene expression in Sertoli cells by follicle-stimulating hormone (FSH): cloning and characterization of LRPR1, a primary response gene encoding a leucine-rich protein.
1538749 1992 Sequence identification of 2,375 human brain genes.