Property Summary

NCBI Gene PubMed Count 57
PubMed Score 102.97
PubTator Score 94.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 2.000 8.6e-05
psoriasis 1.400 1.1e-74
glioblastoma 3.300 3.5e-10
posterior fossa group A ependymoma 2.500 1.6e-06
group 3 medulloblastoma 4.700 1.9e-08
atypical teratoid / rhabdoid tumor 3.600 1.2e-11
medulloblastoma, large-cell 4.400 1.6e-06
primitive neuroectodermal tumor 3.800 6.2e-07
Atopic dermatitis 1.600 5.7e-05
adrenocortical carcinoma 2.162 1.4e-04
non-small cell lung cancer 3.512 1.5e-36
intraductal papillary-mucinous carcinoma... 3.100 6.1e-06
intraductal papillary-mucinous neoplasm ... 3.000 2.5e-03
lung cancer 5.800 8.2e-07
colon cancer 2.000 1.7e-03
pancreatic cancer 1.700 4.9e-06
breast carcinoma 2.600 6.7e-06
Breast cancer 4.600 2.2e-02
lung adenocarcinoma 2.500 6.8e-09
pediatric high grade glioma 3.100 1.4e-06
nasopharyngeal carcinoma 1.900 7.8e-05
Endometriosis 1.757 7.2e-03
ductal carcinoma in situ 2.600 3.7e-04
invasive ductal carcinoma 3.100 6.1e-05
ovarian cancer 2.800 1.3e-09

Gene RIF (33)

PMID Text
26259702 Miro and Cenp-F promote anterograde mitochondrial movement and proper mitochondrial distribution in daughter cells.
26188054 Mitosin and pHH3 immunostaining predict poorer survival in astrocytomas WHO grades II and III.
26101217 N-terminal microtubule-binding domain of CENP-F prefers curled oligomers of tubulin relative to microtubule walls by approximately fivefold, suggesting it may contribute to the firm bonds between kinetochores and flared plus ends of dynamic microtubules
25647485 the increased expression of CENPF plays an important role in the progression of PCa.
25564561 Our data identify CENPF as a new centriolar disease gene implicated in severe human ciliopathy and microcephaly related phenotypes
24823640 FOXM1 and CENPF function synergistically to promote tumor growth by coordinated regulation of target gene expression and activation of key signaling pathways associated with prostate cancer malignancy.
23791740 data suggest that CENPF is frequently overexpressed in HCC and plays a critical role in driving HCC tumorigenesis
23163484 CENP-F may serve as valuable molecular marker for predicting prognosis of ESCC patients. data indicate potential benefit of combining ZOL with cisplatin in ESCC; CENP-F expressionmay have therapeutic implications.
23097494 Data suggest that ASUN promotes perinuclear enrichment of dynein at G2/M that facilitates BICD2- and CENP-F-mediated anchoring of dynein to nuclear pore complexes.
22912832 Coincidently amplified CDK13, GMNN, and CENPF genes can play a role as common cancer-driver genes in human cancers.
21987812 Rab5 forms a complex with a subset of CENP-F in mitotic cells and regulates the kinetics of release of CENP-F from the nuclear envelope and its accumulation on kinetochores.
21613637 Centromere protein F and survivin are malignant behaviour markers for colorectal gastrointestinal stromal tumours.
20978035 Cenp-F plays a role in organization of interphase chromatin through association and possibly regulation of DNA-PK.
20828406 Data suggest that CENP-F protein is a valuable marker of nasopharyngeal carcinoma progression, and CENP-F expression is associated with poor overall survival of patients.
20660191 the interaction between LANA and the kinetochore proteins CENP-F and Bub1 is important for KSHV genome tethering and its segregation to new daughter cells
20398247 Mitosin did not predict patient survival in this series of cutaneous melanomas.
20213041 These results uncover a novel role of CENP-F in regulation of epigenetic modification on histone H3.
20053638 Data show that the post-anaphase, KEN-box-dependent degradation of Cenp-F requires it to be farnesylated, a post-translational modification usually linked to membrane association.
20015195 Data identified Cenp-F as a potential new molecular target for NBPs in tumour cells.
19723035 Study analyzed the distribution of PARP-1 and its interaction with CENP-B, -E, and -F during mitosis and apoptosis.
19102762 high expression levels of the CENP-F appeared to be the molecular background of higher proliferative activity, and they were correlated with high SUV (standardized uptake value) in breast cancer
19008095 Observational study of gene-disease association. (HuGE Navigator)
17600710 Ndel1, Nde1, and Lis1 localize to kinetochores in a Cenp-F-dependent manner.
17205517 CENP-F upregulation was significantly associated breast cancer
16601978 CENP-F is a novel microtubule-binding protein that possesses two microtubule-binding domains at opposite ends of the molecule. The C-terminal microtubule-binding domain was found to stimulate microtubule polymerization in vitro.
16456711 REVIEW: involvement in mitotic control, microtubule dynamics, transcriptional regulation, and muscle cell differentiation.
16252009 Data show that the absence of nuclear CENP-F does not affect cell cycle progression in S and G2, and that CENP-F is crucial for efficient assembly of a stable microtubule-kinetochore interface.
16219694 In addition to regulating kinetochore-microtubule interactions, Cenp-F might be required to protect centromeric cohesion prior to anaphase commitment.
15870278 Mitosin is therefore essential for full chromosome alignment, possibly by promoting proper kinetochore attachments through modulating CENP-E and dynein functions
15677469 Results suggest that mitosin is a negative regulator of ATF4 in interphase through direct interaction.
14720137 CENP-F expression presents a theoretical advantage for the analysis of the precise cell cycle of G2 to M cells, compared to Ki-67.
12974617 Data show that mitosin associates preferentially with kinetochores of unaligned chromosomes.
12154071 Data suggest that farnesylation of Cenp-F is required not only for its localisation to the nuclear envelope and kinetochores but also for timely progression through G2/M and its degradation after mitosis.

AA Sequence

MSWALEEWKEGLPTRALQKIQELEGQLDKLKKEKQQRQFQLDSLEAALQKQKQKVENEKTEGTNLKRENQ      1 - 70
RLMEICESLEKTKQKISHELQVKESQVNFQEGQLNSGKKQIEKLEQELKRCKSELERSQQAAQSADVSLN     71 - 140
PCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKRLEAEVKALQAKKASQTLPQATMNHRDIARH    141 - 210
QASSSVFSWQQEKTPSHLSSNSQRTPIRRDFSASYFSGEQEVTPSRSTLQIGKRDANSSFFDNSSSPHLL    211 - 280
DQLKAQNQELRNKINELELRLQGHEKEMKGQVNKFQELQLQLEKAKVELIEKEKVLNKCRDELVRTTAQY    281 - 350
DQASTKYTALEQKLKKLTEDLSCQRQNAESARCSLEQKIKEKEKEFQEELSRQQRSFQTLDQECIQMKAR    351 - 420
LTQELQQAKNMHNVLQAELDKLTSVKQQLENNLEEFKQKLCRAEQAFQASQIKENELRRSMEEMKKENNL    421 - 490
LKSHSEQKAREVCHLEAELKNIKQCLNQSQNFAEEMKAKNTSQETMLRDLQEKINQQENSLTLEKLKLAV    491 - 560
ADLEKQRDCSQDLLKKREHHIEQLNDKLSKTEKESKALLSALELKKKEYEELKEEKTLFSCWKSENEKLL    561 - 630
TQMESEKENLQSKINHLETCLKTQQIKSHEYNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAY    631 - 700
MELQQKAEFSDQKHQKEIENMCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYESLRDLLKSK    701 - 770
DASLVTNEDHQRSLLAFDQQPAMHHSFANIIGEQGSMPSERSECRLEADQSPKNSAILQNRVDSLEFSLE    771 - 840
SQKQMNSDLQKQCEELVQIKGEIEENLMKAEQMHQSFVAETSQRISKLQEDTSAHQNVVAETLSALENKE    841 - 910
KELQLLNDKVETEQAEIQELKKSNHLLEDSLKELQLLSETLSLEKKEMSSIISLNKREIEELTQENGTLK    911 - 980
EINASLNQEKMNLIQKSESFANYIDEREKSISELSDQYKQEKLILLQRCEETGNAYEDLSQKYKAAQEKN    981 - 1050
SKLECLLNECTSLCENRKNELEQLKEAFAKEHQEFLTKLAFAEERNQNLMLELETVQQALRSEMTDNQNN   1051 - 1120
SKSEAGGLKQEIMTLKEEQNKMQKEVNDLLQENEQLMKVMKTKHECQNLESEPIRNSVKERESERNQCNF   1121 - 1190
KPQMDLEVKEISLDSYNAQLVQLEAMLRNKELKLQESEKEKECLQHELQTIRGDLETSNLQDMQSQEISG   1191 - 1260
LKDCEIDAEEKYISGPHELSTSQNDNAHLQCSLQTTMNKLNELEKICEILQAEKYELVTELNDSRSECIT   1261 - 1330
ATRKMAEEVGKLLNEVKILNDDSGLLHGELVEDIPGGEFGEQPNEQHPVSLAPLDESNSYEHLTLSDKEV   1331 - 1400
QMHFAELQEKFLSLQSEHKILHDQHCQMSSKMSELQTYVDSLKAENLVLSTNLRNFQGDLVKEMQLGLEE   1401 - 1470
GLVPSLSSSCVPDSSSLSSLGDSSFYRALLEQTGDMSLLSNLEGAVSANQCSVDEVFCSSLQTYVDSLKA   1471 - 1540
ENLVLSTNLRNFQGDLVKEMQLGLEEGLVPSLSSSCVPDSSSLSSLGDSSFYRALLEQTGDMSLLSNLEG   1541 - 1610
VVSANQCSVDEVFCSSLQEENLTRKETPSAPAKGVEELESLCEVYRQSLEKLEEKMESQGIMKNKEIQEL   1611 - 1680
EQLLSSERQELDCLRKQYLSENEQWQQKLTSVTLEMESKLAAEKKQTEQLSLELEVARLQLQGLDLSSRS   1681 - 1750
LLGIDTEDAIQGRNESCDISKEHTSETTERTPKHDVHQICDKDAQQDLNLDIEKITETGAVKPTGECSGE   1751 - 1820
QSPDTNYEPPGEDKTQGSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRD   1821 - 1890
RKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRVETSE   1891 - 1960
GLNSDLEMHADKSSREDIGDNVAKVNDSWKERFLDVENELSRIRSEKASIEHEALYLEADLEVVQTEKLC   1961 - 2030
LEKDNENKQKVIVCLEEELSVVTSERNQLRGELDTMSKKTTALDQLSEKMKEKTQELESHQSECLHCIQV   2031 - 2100
AEAEVKEKTELLQTLSSDVSELLKDKTHLQEKLQSLEKDSQALSLTKCELENQIAQLNKEKELLVKESES   2101 - 2170
LQARLSESDYEKLNVSKALEAALVEKGEFALRLSSTQEEVHQLRRGIEKLRVRIEADEKKQLHIAEKLKE   2171 - 2240
RERENDSLKDKVENLERELQMSEENQELVILDAENSKAEVETLKTQIEEMARSLKVFELDLVTLRSEKEN   2241 - 2310
LTKQIQEKQGQLSELDKLLSSFKSLLEEKEQAEIQIKEESKTAVEMLQNQLKELNEAVAALCGDQEIMKA   2311 - 2380
TEQSLDPPIEEEHQLRNSIEKLRARLEADEKKQLCVLQQLKESEHHADLLKGRVENLERELEIARTNQEH   2381 - 2450
AALEAENSKGEVETLKAKIEGMTQSLRGLELDVVTIRSEKENLTNELQKEQERISELEIINSSFENILQE   2451 - 2520
KEQEKVQMKEKSSTAMEMLQTQLKELNERVAALHNDQEACKAKEQNLSSQVECLELEKAQLLQGLDEAKN   2521 - 2590
NYIVLQSSVNGLIQEVEDGKQKLEKKDEEISRLKNQIQDQEQLVSKLSQVEGEHQLWKEQNLELRNLTVE   2591 - 2660
LEQKIQVLQSKNASLQDTLEVLQSSYKNLENELELTKMDKMSFVEKVNKMTAKETELQREMHEMAQKTAE   2661 - 2730
LQEELSGEKNRLAGELQLLLEEIKSSKDQLKELTLENSELKKSLDCMHKDQVEKEGKVREEIAEYQLRLH   2731 - 2800
EAEKKHQALLLDTNKQYEVEIQTYREKLTSKEECLSSQKLEIDLLKSSKEELNNSLKATTQILEELKKTK   2801 - 2870
MDNLKYVNQLKKENERAQGKMKLLIKSCKQLEEEKEILQKELSQLQAAQEKQKTGTVMDTKVDELTTEIK   2871 - 2940
ELKETLEEKTKEADEYLDKYCSLLISHEKLEKAKEMLETQVAHLCSQQSKQDSRGSPLLGPVVPGPSPIP   2941 - 3010
SVTEKRLSSGQNKASGKRQRSSGIWENGRGPTPATPESFSKKSKKAVMSGIHPAEDTEGTEFEPEGLPEV   3011 - 3080
VKKGFADIPTGKTSPYILRRTTMATRTSPRLAAQKLALSPLSLGKENLAESSKPTAGGSRSQKVKVAQRS   3081 - 3150
PVDSGTILREPTTKSVPVNNLPERSPTDSPREGLRVKRGRLVPSPKAGLESNGSENCKVQ             3151 - 3210
//

Text Mined References (71)

PMID Year Title
26820108 2016 Strømme Syndrome Is a Ciliary Disorder Caused by Mutations in CENPF.
26259702 2015 Mitotic redistribution of the mitochondrial network by Miro and Cenp-F.
26188054 2016 Mitosin and pHH3 predict poorer survival in astrocytomas WHO grades II and III.
26101217 2015 Centromere protein F includes two sites that couple efficiently to depolymerizing microtubules.
25647485 2015 Enhanced expression of centromere protein F predicts clinical progression and prognosis in patients with prostate cancer.
25564561 2015 The kinetochore protein, CENPF, is mutated in human ciliopathy and microcephaly phenotypes.
24823640 2014 Cross-species regulatory network analysis identifies a synergistic interaction between FOXM1 and CENPF that drives prostate cancer malignancy.
23791740 2013 Characterization of the oncogenic function of centromere protein F in hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163484 2013 Prognostic relevance and therapeutic implications of centromere protein F expression in patients with esophageal squamous cell carcinoma.
23097494 2012 Human Asunder promotes dynein recruitment and centrosomal tethering to the nucleus at mitotic entry.
22912832 2012 Frequent amplification of CENPF, GMNN and CDK13 genes in hepatocellular carcinomas.
21987812 2011 Small GTPase Rab5 participates in chromosome congression and regulates localization of the centromere-associated protein CENP-F to kinetochores.
21659360 2011 Association between single nucleotide polymorphism-genotype and outcome of patients with chronic lymphocytic leukemia in a randomized chemotherapy trial.
21613637 2011 Centromere protein F and survivin are associated with high risk and a poor prognosis in colorectal gastrointestinal stromal tumours.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20978035 2010 Involvement of Cenp-F in interphase chromatin organization possibly through association with DNA-dependent protein kinase.
20828406 2010 Prognostic significance and therapeutic implications of centromere protein F expression in human nasopharyngeal carcinoma.
20660191 2010 Bub1 and CENP-F can contribute to Kaposi's sarcoma-associated herpesvirus genome persistence by targeting LANA to kinetochores.
20398247 2010 Ki-67 expression is superior to mitotic count and novel proliferation markers PHH3, MCM4 and mitosin as a prognostic factor in thick cutaneous melanoma.
20213041 2010 Involvement of CENP-F in histone methylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20053638 2010 Cdc20 is required for the post-anaphase, KEN-dependent degradation of centromere protein F.
20015195 2011 The kinetochore protein Cenp-F is a potential novel target for zoledronic acid in breast cancer cells.
19723035 2009 Distribution of centromeric proteins and PARP-1 during mitosis and apoptosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19102762 2008 Expression of centromere protein F (CENP-F) associated with higher FDG uptake on PET/CT, detected by cDNA microarray, predicts high-risk patients with primary breast cancer.
19008095 2009 Single nucleotide polymorphisms in chromosomal instability genes and risk and clinical outcome of breast cancer: a Swedish prospective case-control study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17600710 2007 Cenp-F links kinetochores to Ndel1/Nde1/Lis1/dynein microtubule motor complexes.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17205517 2007 CENP-F expression is associated with poor prognosis and chromosomal instability in patients with primary breast cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16601978 2006 CENP-F is a novel microtubule-binding protein that is essential for kinetochore attachments and affects the duration of the mitotic checkpoint delay.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16456711 2006 Mitosin/CENP-F in mitosis, transcriptional control, and differentiation.
16252009 2005 Unstable microtubule capture at kinetochores depleted of the centromere-associated protein CENP-F.
16219694 2005 Silencing Cenp-F weakens centromeric cohesion, prevents chromosome alignment and activates the spindle checkpoint.
15927522 2005 Correlation of CENP-F gene expression with tumor-proliferating activity in human salivary gland tumors.
15870278 2005 Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death.
15677469 2005 Mitosin/CENP-F as a negative regulator of activating transcription factor-4.
15494374 2004 GW182 is critical for the stability of GW bodies expressed during the cell cycle and cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14720137 2004 Immunohistochemical analysis of centromere protein F expression in buccal and gingival squamous cell carcinoma.
12974617 2003 Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport.
12507285 2003 Mitosin, a novel marker of cell proliferation and early recurrence in intracranial meningiomas.
12467231 2001 Synergistic interaction of lovastatin and paclitaxel in human cancer cells.
12154071 2002 Farnesylation of Cenp-F is required for G2/M progression and degradation after mitosis.
11549288 2001 M phase-specific association of human topoisomerase IIIbeta with chromosomes.
11084331 2000 Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype.
10852915 2000 Farnesyl transferase inhibitors block the farnesylation of CENP-E and CENP-F and alter the association of CENP-E with the microtubules.
10373470 1999 The cloning and analysis of LEK1 identifies variations in the LEK/centromere protein F/mitosin gene family.
9950165 1999 Immunohistochemical analysis of the proliferation associated nuclear antigen CENP-F in non-Hodgkin's lymphoma.
9891037 1999 Structural requirements and dynamics of mitosin-kinetochore interaction in M phase.
9763420 1998 Characterization of the kinetochore binding domain of CENP-E reveals interactions with the kinetochore proteins CENP-F and hBUBR1.
9497340 1998 Identification of a novel cytoplasmic protein that specifically binds to nuclear localization signal motifs.
7904902 1993 CENP-F is a .ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization.
7851898 1994 Chromosomal localization of the genes encoding the kinetochore proteins CENPE and CENPF to human chromosomes 4q24-->q25 and 1q32-->q41, respectively, by fluorescence in situ hybridization.
7651420 1995 Characterization of a novel 350-kilodalton nuclear phosphoprotein that is specifically involved in mitotic-phase progression.
7642639 1995 The C terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization.
7612011 1995 A novel cell-cycle-dependent 350-kDa nuclear protein: C-terminal domain sufficient for nuclear localization.
7542657 1995 CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis.