Property Summary

NCBI Gene PubMed Count 42
PubMed Score 201.76
PubTator Score 195.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.300 2.7e-06
osteosarcoma 1.093 6.2e-03
atypical teratoid / rhabdoid tumor 1.500 1.3e-05
glioblastoma 2.100 7.7e-08
medulloblastoma, large-cell 1.200 3.5e-04
pediatric high grade glioma 1.300 3.8e-04

Gene RIF (19)

PMID Text
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25916850 The results revealed that CENP-B binding in the vicinity of the CENP-A nucleosome substantially stabilizes the CENP-A nucleosome on alphoid DNA in human cells.
25281565 Centromere protein B (CENP-B) as a novel interacting partner of HBZ.
24633075 INMAP as a model regulator of CENP-B
23978223 N-terminal methylation is required for CENP-B's binding to the CENP-B box.
23325853 Human Nap1, an acidic histone chaperone, inhibited the non-specific binding of CENP-B to nucleosomes and apparently stimulated CENP-B binding to its cognate CENP-B box DNA.
22467948 CENP-A and/or B status is predictive of the extent of skin involvement over time in systemic sclerosis.
20222802 Anti-CENP-B autoantibodies in breast cancer patients prolong disease-free and overall survival.
19723035 Study analyzed the distribution of PARP-1 and its interaction with CENP-B, -E, and -F during mitosis and apoptosis.
19714638 CENP-B binding stimulated the cross-talk between CCR3 and epidermal growth factor receptor (EGFR) in human pulmonary artery smooth muscle cells.
19412974 Acceptor-bleaching FRET indicates that CENP-T directly associates with CENP-A and CENP-B.
18072184 observation of FRET between CENP-A and CENP-B at centromere locations; this indicates that these proteins are in the molecular vicinity (<10 nm) of each other
17968937 CENP-B was found to bind specifically to the surface of human pulmonary artery smooth muscle cells and not to fibroblasts or endothelial cells
17258208 This study shows that ICP0 induces the proteasomal-dependent degradation of the centromeric protein CENP-B in infected as well as ICP0-expressing cells.
16183641 CENP-B may be a determinant for translational positioning of the centromere-specific nucleosomes through its binding to the nucleosomal CENP-B box
15634350 CENP-B for the CENP-B box DNA is reduced nearly to the level of nonspecific DNA binding by CpG methylation
14612452 the interaction between CENP-B and CENP-C may be involved in the correct assembly of CENP-C on alphoid DNA
14522975 crystal structure of its dimerization domain (CENP-B-(540-599)), another functional domain of CENP-B, at 1.65-A resolution
11884609 CENP-A, -B, and -C chromatin complex that contains the I-type alpha-satellite array constitutes the prekinetochore in HeLa cells

AA Sequence

MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNK      1 - 70
LSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVAR     71 - 140
ARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPPSVAEGYASQDVFSATETSLWYDFLPDQAAG    141 - 210
LCGGDGRPRQATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKA    211 - 280
LDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALE    281 - 350
GQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEG    351 - 420
EGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEGLEAEDWAQGVVEAGGSFGAY    421 - 490
GAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTS    491 - 560
FPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS                                   561 - 599
//

Text Mined References (49)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25916850 2015 Stable complex formation of CENP-B with the CENP-A nucleosome.
25281565 2015 HTLV-1 bZIP factor suppresses the centromere protein B (CENP-B)-mediated trimethylation of histone H3K9 through the abrogation of DNA-binding ability of CENP-B.
24633075 2014 A regulatory effect of INMAP on centromere proteins: antisense INMAP induces CENP-B variation and centromeric halo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23978223 2013 Identification of novel ?-n-methylation of CENP-B that regulates its binding to the centromeric DNA.
23325853 2013 Nap1 regulates proper CENP-B binding to nucleosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22467948 2012 Clinical correlates of CENP-A and CENP-B antibodies in a large cohort of patients with systemic sclerosis.
20222802 2010 Anti-CENP-B antibodies are associated with prolonged survival in breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19723035 2009 Distribution of centromeric proteins and PARP-1 during mitosis and apoptosis.
19714638 2009 Nuclear autoantigen CENP-B transactivation of the epidermal growth factor receptor via chemokine receptor 3 in vascular smooth muscle cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19412974 2008 Live-cell imaging reveals sustained centromere binding of CENP-T via CENP-A and CENP-B.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18072184 2008 Assembly of the inner kinetochore proteins CENP-A and CENP-B in living human cells.
17968937 2007 The nuclear autoantigen CENP-B displays cytokine-like activities toward vascular smooth muscle cells.
17258208 2007 Centromeric protein CENP-B proteasomal degradation induced by the viral protein ICP0.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16183641 2005 Human centromere protein B induces translational positioning of nucleosomes on alpha-satellite sequences.
15635413 2005 Nucleolar proteome dynamics.
15634350 2005 CpG methylation of the CENP-B box reduces human CENP-B binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14612452 2004 CENP-B interacts with CENP-C domains containing Mif2 regions responsible for centromere localization.
14522975 2003 Crystal structure of the human centromere protein B (CENP-B) dimerization domain at 1.65-A resolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217960 2002 Poly(ADP-ribose) polymerase 2 localizes to mammalian active centromeres and interacts with PARP-1, Cenpa, Cenpb and Bub3, but not Cenpc.
12011073 2002 Centromere proteins Cenpa, Cenpb, and Bub3 interact with poly(ADP-ribose) polymerase-1 protein and are poly(ADP-ribosyl)ated.
11884609 2002 CENP-A, -B, and -C chromatin complex that contains the I-type alpha-satellite array constitutes the prekinetochore in HeLa cells.
11812799 2002 The basic helix-loop-helix factor, HAND2, functions as a transcriptional activator by binding to E-boxes as a heterodimer.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11726497 2001 Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA.
11682612 2001 Specification of kinetochore-forming chromatin by the histone H3 variant CENP-A.
11084331 2000 Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype.
9451007 1998 A helix-turn-helix structure unit in human centromere protein B (CENP-B).
8406460 1993 Mapping of the human CENP-B gene to chromosome 20 and the CENP-C gene to chromosome 12 by a rapid cycle DNA amplification procedure.
8198697 1994 Eukaryotic expression of recombinant human centromere autoantigen and its use in a novel ELISA for diagnosis of CREST syndrome.
7896278 1994 Mapping of the human centromere protein B gene (CENPB) to chromosome 20p13 by fluorescence in situ hybridization.
7862152 1995 Analysis of protein-DNA and protein-protein interactions of centromere protein B (CENP-B) and properties of the DNA-CENP-B complex in the cell cycle.
2435739 1987 Molecular cloning of cDNA for CENP-B, the major human centromere autoantigen.
2335558 1990 CENP-B: a major human centromere protein located beneath the kinetochore.
2022189 1991 CENP-E, a novel human centromere-associated protein required for progression from metaphase to anaphase.
1893793 1991 CENP-B is a highly conserved mammalian centromere protein with homology to the helix-loop-helix family of proteins.
1740467 1992 Identification of a subdomain of CENP-B that is necessary and sufficient for localization to the human centromere.
1469042 1992 A human centromere protein, CENP-B, has a DNA binding domain containing four potential alpha helices at the NH2 terminus, which is separable from dimerizing activity.