Property Summary

NCBI Gene PubMed Count 98
PubMed Score 532.85
PubTator Score 327.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 2.000 2.2e-07
glioblastoma 3.500 1.9e-05
osteosarcoma -2.013 2.2e-02
posterior fossa group A ependymoma 2.100 5.3e-06
group 3 medulloblastoma 4.200 1.1e-09
atypical teratoid / rhabdoid tumor 3.600 5.0e-13
medulloblastoma, large-cell 3.900 1.6e-07
primitive neuroectodermal tumor 3.800 1.3e-07
Atopic dermatitis 1.400 1.6e-03
adrenocortical carcinoma 1.947 1.5e-03
non-small cell lung cancer 3.483 2.1e-33
intraductal papillary-mucinous carcinoma... 2.300 2.7e-04
intraductal papillary-mucinous neoplasm ... 2.700 6.0e-04
colon cancer 1.800 7.5e-03
lung cancer 3.200 6.7e-05
pancreatic cancer 1.200 1.2e-04
lung adenocarcinoma 1.500 6.0e-06
pediatric high grade glioma 3.000 1.2e-06
psoriasis 1.400 1.0e-08
nasopharyngeal carcinoma 1.200 5.5e-04
Endometriosis 1.758 1.2e-02
Breast cancer 3.000 1.5e-17
breast carcinoma 1.400 7.2e-30
ductal carcinoma in situ 2.500 2.3e-03
invasive ductal carcinoma 3.400 1.3e-04
ulcerative colitis 1.300 5.9e-04
ovarian cancer 2.400 9.3e-06

Gene RIF (68)

PMID Text
26878239 The authors found that the nucleosome shape change directed by CENP-A is dominated by lateral passing of two DNA gyres (gyre sliding).
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
25954010 CENP-C depletion leads to rapid removal of CENP-A from centromeres, indicating their collaboration in maintaining centromere identity.
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25795299 the CRL4 complex containing RBBP7 (CRL4(RBBP7)) might regulate mitosis by promoting ubiquitin-dependent loading of newly synthesized CENP-A during the G1 phase of the cell cycle.
25786215 The DNA ends of the CENP-A nucleosome are more flexible than those of the H3 nucleosome.
25713413 results indicate that the regions of CENP-A required for early events in centromere establishment differ from those that are required for maintaining centromere identity.
25408271 The CENP-A/histone H3.3 nucleosome forms an unexpectedly stable structure and allows the binding of the essential centromeric protein, CENP-C, which is ectopically mislocalized in the chromosomes of CENP-A overexpressing tumor cells.
25117489 The study describes a novel function for human centromeric long non-coding RNAs in the recruitment of HJURP and CENP-A, implicating RNA-based chaperone targeting in histone variant assembly.
25036634 Study identifies Plk1 as a centromere-localized regulator required to initiate CENP-A deposition in human cells and faithful CENP-A deposition requires integrated signals from Plk1 and CDK, with Plk1 promoting the localization of the key CENP-A deposition factor, the Mis18 complex, and CDK inhibiting Mis18 complex assembly.
24530302 DAXX has a role in misregulation of localization of the centromeric histone variant CenH3/CENP-A
24440098 our results demonstrate that elevated CENP-A expression is significantly associated with osteosarcoma progression
23890477 Ser7 phosphorylated CENP-A acts as a chromosomal passenger protein and may play an important role in cytokinesis.
23818633 Posttranslational modification of CENP-A influences the conformation of centromeric chromatin.
23771058 a mechanism whereby the CENP-A pre-nucleosomal complex achieves assembly of the octameric CENP-A nucleosome through the dimerization of the CENP-A chaperone HJURP.
23712606 CENP-A could play an important role in epithelial ovarian cancer and might serve as a valuable prognostic marker and potential target for gene therapy.
23657009 14-3-3 proteins could act as specific mitotic "bridges," linking phosphorylated CENP-A and CENP-C, which are necessary for the platform function of CENP-A centromeric chromatin
23644598 Authors demonstrate that octameric CENP-A nucleosomes assembled in vitro exhibit reduced heights, indicating that they are physically distinct from H3 nucleosomes and negating the need to invoke the presence of hemisomes.
23644596 Authors show that the predominant form of the CENP-A particle at human centromeres is an octameric nucleosome.
23623556 This study found that that octameric CENP-A nucleosomes mark the centromeric region to ensure proper epigenetic inheritance and kinetochore assembly.
23613856 anti-CENP-A(1-17) antibodies are generated independently from anti-CENP-B antibodies
23363600 Data indicate that G1-phase histone assembly is restricted to CENP-A and H4.
23184928 And-1 together with HJURP regulates the assembly of new CENP-A onto centromeres.
22817894 Whereas canonical H3 nucleosomes have octameric dimensions throughout the cell cycle, CENP-A nucleosomes are predominantly tetramers in early G1 phase, alter to octamers at the end of G1 through S phase, and revert to tetramers after replication.
22559056 study found CENP-A to be a strong prognostic marker for distant relapse in ER-positive breast cancer. Even when known clinical factors such as Ki-67 and grade are considered, CENP-A remains an independent prognostic marker for relapse.
22542705 Our results demonstrate that elevated CENP-A expression is closely associated with lung adenocarcinoma progression and has an independent prognostic value in predicting overall survival for patients with lung adenocarcinoma.
22473132 The authors report that de novo CENP-A assembly and kinetochore formation on human centromeric alphoid DNA arrays is regulated by a histone H3K9 acetyl/methyl balance.
22467948 CENP-A and/or B status is predictive of the extent of skin involvement over time in systemic sclerosis.
22127263 structural comparison between CENP-A and H3 in nucleosomes
21956590 overexpression of CENP-A is closely associated with hepatitis B virus x protein COOH mutation in hepatocellular carcinoma
21875947 HIV-1 Vpr and p300/HAT co-localizes with CENP-A and CENP-H proteins in the centromere and arm region of chromosome
21826412 Two neocentromeres formed in chromosome 8q21 with a unique DNA and CENP-A chromatin configuration.
21768289 The data suggest that the role of the Mis18 complex in CENP-A deposition is to recruit HJURP and that the CENP-A nucleosome assembly activity of HJURP is responsible for centromeric chromatin assembly to maintain the epigenetic mark.
21743476 crystal structure of the human centromeric nucleosome containing CENP-A; CENP-A loop 1 may function in stabilizing the centromeric chromatin containing CENP-A, possibly by providing a binding site for trans-acting factors
21478274 The crystal structure of an HJURP-CENP-A-histone H4 complex shows that HJURP binds a CENP-A-H4 heterodimer
21423629 Overexpression of CENP-A is frequently observed in hepatocellular carcinoma.
21399697 UNG2 colocalizes with CENP-A and H2AX phosphorylation at centromeres in normally cycling cells.
21068465 Results report that the level of CENP-A, a protein required for cell division, declines precipitously with age in an islet-specific manner.
21059934 CENP-A nucleosomes are organized as asymmetric heterotypic tetramers rather than canonical octamers, forming a chromatin fiber with distinct folding characteristics
20739937 crystal structure of a subnucleosomal heterotetramer, (CENP-A-H4)(2); results indicate that CENP-A marks centromere location by restructuring the nucleosome from within its folded histone core
20650959 results show pluripotent stem cells have mechanism to maintain genomic integrity by possessing flexibility to reduce CENPA required to maintain functional centromere under self-renewing conditions and maintaining reserve CENPA mRNA to rebuild centromere
20630806 Using autoantibodies from systemic sclerosis (SSc) patients, two anti-CENP-A-specific motifs were defined in its immunodominant epitope Ap17-30. One of these motifs matched residues 53-62 of FOXE3, a protein not previously implicated in SSc.
20566683 CENP-C binds directly to CENP-A chromatin and, together with CENP-N, provides the foundation upon which other centromere and kinetochore proteins are assembled.
20331851 On chromosomes 1 and 19, which are more affected by the above evolutionary mechanisms than are chromosomes 21 and 5, CENP-A associated repeats were also recovered from a second homogeneous array present on each chromosome.
20206496 Studies indicate that CENP-A is strongly favored as the epigenetic mark that specifies centromere identity.
20160010 p53-dependent senescence that arises from CENP-A reduction acts as a "self-defense mechanism" to prevent centromere-defective cells from undergoing mitotic proliferation that potentially leads to massive generation of aneuploid cells.
20080577 found that HJURP, a member of the complex, was required for cell cycle specific targeting of CENP-A to centromeres.
20003272 findings indicate a novel aspect of pRb acute loss that promotes aneuploidy mainly by inducing CENPA overexpression
19717431 The centromere-targeting domain of CENP-A is both necessary and sufficient for recruitment to double-strand breaks. CENP-A accumulation at DNA breaks is enhanced by active non-homologous end-joining but does not require DNA-PKcs or Ligase IV.
19625449 CENP-H-containing complex facilitates deposition of newly synthesized CENP-A into centromeric chromatin in cooperation with FACT and CHD1.
19543270 Data suggest that CENP-N interprets the information encoded within CENP-A nucleosomes and recruits other proteins to centromeric chromatin that are required for centromere function and propagation.
19412974 Acceptor-bleaching FRET indicates that CENP-T directly associates with CENP-A and CENP-B.
19410545 HJURP is a key factor for CENP-A deposition and maintenance at centromeres
19410544 HJURP is a possible cell-cycle-regulated CENP-A-specific histone chaperone required for centromeric chromatin assembly
18072184 data support the view that two CENP-A molecules are packed with H4, but not with H3, in a single centromeric nucleosome
18007590 Results suggest that the cooperative action of CENP-A NAC/CAD subunits and the KMN network drives efficient chromosome segregation and bipolar spindle assembly during mitosis.
17651496 Centromeric chromatin consists of several CENP-A subdomains.
17339380 CENP-A bound to a mature centromere is quantitatively and equally partitioned to sister centromeres generated during S phase, thereby remaining stably associated through multiple cell divisions.
17244537 depletion of CENP-A is lethal, but recruitment of normal levels of kinetochore proteins, centromere-generated mitotic checkpoint signaling, chromosome segregation, and viability can be rescued by histone H3 carrying the CENP-A targeting domain
17199038 Three human proteins essential for centromere/kinetochore structure and function, hMis18alpha, hMis18beta, and M18BP1, the complex of which is accumulated specifically at the telophase-G1 centromere, are identified.
16622420 The CENP-H-I complex may function, in part, as a marker directing CENP-A deposition to centromeres.
16622419 The CENP-A nucleosome associated complex (NAC) is essential, as disruption of the complex causes errors of chromosome alignment and segregation.
15702419 Results suggest a role for increased CENP-A incorporation in the faithful segregation of larger chromosomes & facilitate assembly of larger kinetochore structures.
15282608 the centromere-targeting domain of CENP-A confers a unique structural rigidity to the nucleosomes into which it assembles, and it is likely to have a role in maintaining centromere identity
14667408 phosphorylation of CENP-A on Ser-7 by Aurora-A in prophase is essential for kinetochore function.
12839935 Overexpression of this protein plays an important role for aneuploidy in colorectal cancers.
11884609 CENP-A, -B, and -C chromatin complex that contains the I-type alpha-satellite array constitutes the prekinetochore in HeLa cells

AA Sequence

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL      1 - 70
AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG     71 - 140
//

Text Mined References (107)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26878239 2016 CENP-C directs a structural transition of CENP-A nucleosomes mainly through sliding of DNA gyres.
26543159 2015 Molecular basis for histone N-terminal methylation by NRMT1.
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25954010 2015 Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25795299 2015 CRL4(RBBP7) is required for efficient CENP-A deposition at centromeres.
25786215 2015 Two arginine residues suppress the flexibility of nucleosomal DNA in the canonical nucleosome core.
25713413 2015 Both tails and the centromere targeting domain of CENP-A are required for centromere establishment.
25556658 2015 Dynamic phosphorylation of CENP-A at Ser68 orchestrates its cell-cycle-dependent deposition at centromeres.
25408271 2014 Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3.
25117489 2014 A long non-coding RNA is required for targeting centromeric protein A to the human centromere.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24781148 2014 Histone variants: key players of chromatin.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
24530302 2014 Mislocalization of the centromeric histone variant CenH3/CENP-A in human cells depends on the chaperone DAXX.
24440098 2014 Expression and prognostic relevance of centromere protein A in primary osteosarcoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23890477 2013 Transfer of Ser7 phosphorylated CENP-A from centromere to midbody during mitosis in MCF-7 cells.
23818633 2013 Posttranslational modification of CENP-A influences the conformation of centromeric chromatin.
23771058 2013 Dimerization of the CENP-A assembly factor HJURP is required for centromeric nucleosome deposition.
23712606 2013 Prognostic value of centromere protein-A expression in patients with epithelial ovarian cancer.
23657009 2013 Phosphorylation of the CENP-A amino-terminus in mitotic centromeric chromatin is required for kinetochore function.
23644598 2013 CENP-A confers a reduction in height on octameric nucleosomes.
23644596 2013 The octamer is the major form of CENP-A nucleosomes at human centromeres.
23623556 2013 Octameric CENP-A nucleosomes are present at human centromeres throughout the cell cycle.
23613856 2013 Autoantibodies recognizing the amino terminal 1-17 segment of CENP-A display unique specificities in systemic sclerosis.
23363600 2013 Assembly in G1 phase and long-term stability are unique intrinsic features of CENP-A nucleosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184928 2013 Acidic nucleoplasmic DNA-binding protein (And-1) controls chromosome congression by regulating the assembly of centromere protein A (CENP-A) at centromeres.
22817894 2012 Cell-cycle-dependent structural transitions in the human CENP-A nucleosome in vivo.
22559056 2012 Centromere protein-A, an essential centromere protein, is a prognostic marker for relapse in estrogen receptor-positive breast cancer.
22542705 2012 Expression and prognostic significance of centromere protein A in human lung adenocarcinoma.
22473132 2012 Breaking the HAC Barrier: histone H3K9 acetyl/methyl balance regulates CENP-A assembly.
22467948 2012 Clinical correlates of CENP-A and CENP-B antibodies in a large cohort of patients with systemic sclerosis.
22127263 Comparison between the CENP-A and histone H3 structures in nucleosomes.
21956590 2012 Hepatitis B virus X protein mutant upregulates CENP-A expression in hepatoma cells.
21826412 2011 Formation of novel CENP-A domains on tandem repetitive DNA and across chromosome breakpoints on human chromosome 8q21 neocentromeres.
21768289 2011 HJURP is a CENP-A chromatin assembly factor sufficient to form a functional de novo kinetochore.
21743476 2011 Crystal structure of the human centromeric nucleosome containing CENP-A.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21478274 2011 Structure of a CENP-A-histone H4 heterodimer in complex with chaperone HJURP.
21423629 2011 ShRNA-targeted centromere protein A inhibits hepatocellular carcinoma growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399697 2011 Uracil DNA N-glycosylase promotes assembly of human centromere protein A.
21068465 2010 CENP-A, a protein required for chromosome segregation in mitosis, declines with age in islet but not exocrine cells.
21059934 2010 Tetrameric organization of vertebrate centromeric nucleosomes.
20739937 2010 The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
20650959 2010 Centromere protein A dynamics in human pluripotent stem cell self-renewal, differentiation and DNA damage.
20630806 2010 The immunodominant epitope of centromere-associated protein A displays homology with the transcription factor forkhead box E3 (FOXE3).
20566683 2010 Dual recognition of CENP-A nucleosomes is required for centromere assembly.
20331851 2010 Molecular and evolutionary characteristics of the fraction of human alpha satellite DNA associated with CENP-A at the centromeres of chromosomes 1, 5, 19, and 21.
20206496 2010 Building centromeres: home sweet home or a nomadic existence?
20160010 2010 CENP-A reduction induces a p53-dependent cellular senescence response to protect cells from executing defective mitoses.
20080577 2010 HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres.
20003272 2009 CENPA overexpression promotes genome instability in pRb-depleted human cells.
19717431 2009 Double-strand DNA breaks recruit the centromeric histone CENP-A.
19625449 2009 CENP-H-containing complex facilitates centromere deposition of CENP-A in cooperation with FACT and CHD1.
19543270 2009 Centromere assembly requires the direct recognition of CENP-A nucleosomes by CENP-N.
19533040 2009 Cancer-upregulated gene 2 (CUG2), a new component of centromere complex, is required for kinetochore function.
19503796 2009 The C-terminal domain of CENP-C displays multiple and critical functions for mammalian centromere formation.
19468067 2009 Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly.
19412974 2008 Live-cell imaging reveals sustained centromere binding of CENP-T via CENP-A and CENP-B.
19410545 2009 HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres.
19410544 2009 Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.
19114591 2008 Three-dimensional localization of CENP-A suggests a complex higher order structure of centromeric chromatin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18239465 2008 Aurora-C and Aurora-B share phosphorylation and regulation of CENP-A and Borealin during mitosis.
18195732 2008 Cyclin B1 is localized to unattached kinetochores and contributes to efficient microtubule attachment and proper chromosome alignment during mitosis.
18072184 2008 Assembly of the inner kinetochore proteins CENP-A and CENP-B in living human cells.
18007590 2007 The CENP-A NAC/CAD kinetochore complex controls chromosome congression and spindle bipolarity.
17651496 2007 Co-localization of CENP-C and CENP-H to discontinuous domains of CENP-A chromatin at human neocentromeres.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17339380 2007 Propagation of centromeric chromatin requires exit from mitosis.
17244537 2007 Centromere identity maintained by nucleosomes assembled with histone H3 containing the CENP-A targeting domain.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17199038 2007 Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15702419 2004 Chromosome size and origin as determinants of the level of CENP-A incorporation into human centromeres.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475964 2004 Centromeric chromatin exhibits a histone modification pattern that is distinct from both euchromatin and heterochromatin.
15282608 2004 Structural determinants for generating centromeric chromatin.
15085137 2004 Cdc42 and mDia3 regulate microtubule attachment to kinetochores.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14667408 2003 CENP-A phosphorylation by Aurora-A in prophase is required for enrichment of Aurora-B at inner centromeres and for kinetochore function.
12839935 2003 Overexpression and mistargeting of centromere protein-A in human primary colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217960 2002 Poly(ADP-ribose) polymerase 2 localizes to mammalian active centromeres and interacts with PARP-1, Cenpa, Cenpb and Bub3, but not Cenpc.
12019018 2002 Molecular cloning and sequence analysis of hamster CENP-A cDNA.
12011073 2002 Centromere proteins Cenpa, Cenpb, and Bub3 interact with poly(ADP-ribose) polymerase-1 protein and are poly(ADP-ribosyl)ated.
11884609 2002 CENP-A, -B, and -C chromatin complex that contains the I-type alpha-satellite array constitutes the prekinetochore in HeLa cells.
11756469 2001 CENP-A is phosphorylated by Aurora B kinase and plays an unexpected role in completion of cytokinesis.
11682612 2001 Specification of kinetochore-forming chromatin by the histone H3 variant CENP-A.
11084331 2000 Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype.
11053442 2001 Degradation of nucleosome-associated centromeric histone H3-like protein CENP-A induced by herpes simplex virus type 1 protein ICP0.
10759786 2000 Autoepitopes on autoantigen centromere protein-A (CENP-A) are restricted to the N-terminal region, which has no homology with histone H3.
9605877 1997 Chromosomal localization of mouse Cenpa gene.
9475158 1998 A novel centromere monospecific serum to a human autoepitope on the histone H3-like protein CENP-A.
9024683 1997 Assembly of CENP-A into centromeric chromatin requires a cooperative array of nucleosomal DNA contact sites.
7962047 1994 Human CENP-A contains a histone H3 related histone fold domain that is required for targeting to the centromere.
2023923 1991 Purification of the centromere-specific protein CENP-A and demonstration that it is a distinctive histone.