Property Summary

NCBI Gene PubMed Count 8
PubMed Score 22.23
PubTator Score 7.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.200 9.3e-08
astrocytic glioma -1.300 3.0e-03
Astrocytoma, Pilocytic -1.100 3.8e-07
atypical teratoid / rhabdoid tumor -2.400 4.6e-12
ependymoma -1.300 1.5e-02
glioblastoma -1.800 5.7e-11
group 3 medulloblastoma -2.000 4.4e-06
medulloblastoma, large-cell -2.300 1.6e-06
primitive neuroectodermal tumor -1.600 1.9e-07
subependymal giant cell astrocytoma -1.145 4.6e-02

Gene RIF (1)

AA Sequence

MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPA      1 - 70
LLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALIL     71 - 140
GVAFLVRKK                                                                 141 - 149
//

Text Mined References (8)

PMID Year Title