Property Summary

NCBI Gene PubMed Count 15
PubMed Score 23.62
PubTator Score 6.92

Knowledge Summary

Patent (1,867)

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.400 1.1e-03
osteosarcoma -1.740 2.4e-05
posterior fossa group A ependymoma -2.500 4.2e-19
glioblastoma -1.500 1.5e-04
lung cancer 4.400 5.6e-07
colon cancer 2.500 1.7e-02
pediatric high grade glioma -1.300 3.8e-05
group 3 medulloblastoma 1.200 1.9e-03
pilocytic astrocytoma -1.800 5.8e-10
subependymal giant cell astrocytoma -1.987 4.0e-02
lung adenocarcinoma 1.100 8.2e-05
lung carcinoma 1.500 1.4e-32
Breast cancer 1.500 1.4e-06
invasive ductal carcinoma 1.100 9.2e-03

 CSPA Cell Line (2)

Gene RIF (4)

PMID Text
25813877 seven-transmembrane domain receptors Celsr3 and Fzd3, in particular, control the development of most longitudinal tracts in the central nervous system. [Review]
25374236 CELSR3 promoter hypermethylation is associated with oral squamous cell carcinoma.
20416094 CELSR3 was found to be selectively up-regulated in tumor stellate cells.
16273260 CELSR3 is one of the core PCP signaling molecules.

AA Sequence

MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGPRAHIGGGALALCPESSGV      1 - 70
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVS     71 - 140
SCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHHGPKPVSSQRNAGTGSRKRVGTARCCGELWA    141 - 210
TGSKGQGERATTSGAERTAPRRNCLPGASGSGPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSRG    211 - 280
LFRCRFLPQRPGPRPPGLPARPEARKVTSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQ    281 - 350
DPDAGEAGRLVYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA    351 - 420
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDP    421 - 490
RSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVREDVRP    491 - 560
HTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPL    561 - 630
SNNTGLASIQVVDINDHIPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFV    631 - 700
INSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAA    701 - 770
VGTSVVSVTAVDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD    771 - 840
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQFRIDADS    841 - 910
GAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSV    911 - 980
LQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTP    981 - 1050
VSIQVMVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIF   1051 - 1120
SGELTALIDLDYEARQEYVIVVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSG   1121 - 1190
IIGRIPAYDPDVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV   1191 - 1260
LRVVIITEELLANSLTVRLENMWQERFLSPLLGRFLEGVAAVLATPAEDVFIFNIQNDTDVGGTVLNVSF   1261 - 1330
SALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCLREPCENYMKCVSVLRFDSSA   1331 - 1400
PFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCRNGGACARREGGYTCVCRPRFTGEDC   1401 - 1470
ELDTEAGRCVPGVCRNGGTCTDAPNGGFRCQCPAGGAFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLS   1471 - 1540
LSFATVQQSGLLFYNGRLNEKHDFLALELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLRYYNK   1541 - 1610
PRTDALGGAQGPSKDKVAVLSVDDCDVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLP   1611 - 1680
ENFPVSHKDFIGCMRDLHIDGRRVDMAAFVANNGTMAGCQAKLHFCDSGPCKNSGFCSERWGSFSCDCPV   1681 - 1750
GFGGKDCQLTMAHPHHFRGNGTLSWNFGSDMAVSVPWYLGLAFRTRATQGVLMQVQAGPHSTLLCQLDRG   1751 - 1820
LLSVTVTRGSGRASHLLLDQVTVSDGRWHDLRLELQEEPGGRRGHHVLMVSLDFSLFQDTMAVGSELQGL   1821 - 1890
KVKQLHVGGLPPGSAEEAPQGLVGCIQGVWLGSTPSGSPALLPPSHRVNAEPGCVVTNACASGPCPPHAD   1891 - 1960
CRDLWQTFSCTCQPGYYGPGCVDACLLNPCQNQGSCRHLPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRG   1961 - 2030
WWGSPTCGPCNCDVHKGFDPNCNKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRP   2031 - 2100
GALGRQCNSCDSPFAEVTASGCRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGAAVRLCDEAQGW   2101 - 2170
LEPDLFNCTSPAFRELSLLLDGLELNKTALDTMEAKKLAQRLREVTGHTDHYFSQDVRVTARLLAHLLAF   2171 - 2240
ESHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAALGQRAPGGSPGSAGLVRHLEEYAATLARNME   2241 - 2310
LTYLNPMGLVTPNIMLSIDRMEHPSSPRGARRYPRYHSNLFRGQDAWDPHTHVLLPSQSPRPSPSEVLPT   2311 - 2380
SSSIENSTTSSVVPPPAPPEPEPGISIIILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFH   2381 - 2450
GRNFLRGILESPISLEFRLLQTANRSKAICVQWDPPGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTF   2451 - 2520
GVLMDASPRERLEGDLELLAVFTHVVVAVSVAALVLTAAILLSLRSLKSNVRGIHANVAAALGVAELLFL   2521 - 2590
LGIHRTHNQLVCTAVAILLHYFFLSTFAWLFVQGLHLYRMQVEPRNVDRGAMRFYHALGWGVPAVLLGLA   2591 - 2660
VGLDPEGYGNPDFCWISVHEPLIWSFAGPVVLVIVMNGTMFLLAARTSCSTGQREAKKTSALTLRSSFLL   2661 - 2730
LLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQGLAVLLLFCVLNADARAAWMPACLGRKAAPEEARPAP   2731 - 2800
GLGPGAYNNTALFEESGLIRITLGASTVSSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSL   2801 - 2870
QAHAGPTDLDVAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLCRAAQSERLLTHP   2871 - 2940
KDVDGNDLLSYWPALGECEAAPCALQTWGSERRLGLDTSKDAANNNQPDPALTSGDETSLGRAQRQRKGI   2941 - 3010
LKNRLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLSQPASRYSSREQLDLLLRRQL   3011 - 3080
SRERLEEAPAPVLRPLSRPGSQECMDAAPGRLEPKDRGSTLPRRQPPRDYPGAMAGRFGSRDALDLGAPR   3081 - 3150
EWLSTLPPPRRTRDLDPQPPPLPLSPQRQLSRDPLLPSRPLDSLSRSSNSREQLDQVPSRHPSREALGPL   3151 - 3220
PQLLRAREDSVSGPSHGPSTEQLDILSSILASFNSSALSSVQSSSTPLGPHTTATPSATASVLGPSTPRS   3221 - 3290
ATSHSISELSPDSEVPRSEGHS                                                   3291 - 3312
//

Text Mined References (17)

PMID Year Title
25813877 2015 Celsr3 and Fzd3 in axon guidance.
25374236 2014 Screening of differential promoter hypermethylated genes in primary oral squamous cell carcinoma.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
20416094 2010 Organ-, inflammation- and cancer specific transcriptional fingerprints of pancreatic and hepatic stellate cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17618280 2007 Opposing roles in neurite growth control by two seven-pass transmembrane cadherins.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16273260 2005 WNT/PCP signaling pathway and human cancer (review).
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10790539 2000 Chromosomal localization of Celsr2 and Celsr3 in the mouse; Celsr3 is a candidate for the tippy (tip) lethal mutant on chromosome 9.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10380929 1999 A striking organization of a large family of human neural cadherin-like cell adhesion genes.
9693030 1998 Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.