Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.79
PubTator Score 14.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (6)

PMID Text
26811534 Authors report a modifying effect of a polymorphism of CELF4 on the dose-dependent association between anthracyclines and cardiomyopathy, which possibly occurs through a pathway that involves the expression of abnormally spliced TNNT2 variants.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911421 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17672918 validated occurrence of an unusual TG 3' splice site in intron 6
14973222 Determination of CELF4 protein domains required for RNA splicing.

AA Sequence

MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEKDL      1 - 70
KPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGG     71 - 140
SSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAIN    141 - 210
ALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVA    211 - 280
QGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANG    281 - 350
QPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEG    351 - 420
CNLFIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY        421 - 486
//

Text Mined References (25)

PMID Year Title
26811534 2016 CELF4 Variant and Anthracycline-Related Cardiomyopathy: A Children's Oncology Group Genome-Wide Association Study.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19911421 2010 Prognostic relevance of DNA copy number changes in colorectal cancer.
19720736 2009 MBNL and CELF proteins regulate alternative splicing of the skeletal muscle chloride channel CLCN1.
19359265 2009 A genome-wide association study identifies a novel locus on chromosome 18q12.2 influencing white cell telomere length.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18521091 2009 Whole genome association study identifies polymorphisms associated with QT prolongation during iloperidone treatment of schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16862542 2006 ETR-3 represses Tau exons 2/3 inclusion, a splicing event abnormally enhanced in myotonic dystrophy type I.
15894795 2005 Identification of CELF splicing activation and repression domains in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009664 2004 Tau exon 10, whose missplicing causes frontotemporal dementia, is regulated by an intricate interplay of cis elements and trans factors.
14973222 2004 ETR-3 and CELF4 protein domains required for RNA binding and splicing activity in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12649496 2003 Antagonistic regulation of alpha-actinin alternative splicing by CELF proteins and polypyrimidine tract binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438720 2002 Identification and characterization of murine Brunol4, a new member of the elav/bruno family.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11158314 2001 The CELF family of RNA binding proteins is implicated in cell-specific and developmentally regulated alternative splicing.
10893231 2000 A family of human RNA-binding proteins related to the Drosophila Bruno translational regulator.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.