Property Summary

NCBI Gene PubMed Count 74
PubMed Score 137.11
PubTator Score 100.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.300 4.5e-03
Multiple myeloma 1.428 5.4e-03
ependymoma 1.200 1.7e-02
oligodendroglioma 1.300 5.4e-03
psoriasis -3.400 5.2e-06
osteosarcoma -1.691 2.3e-08
group 4 medulloblastoma 1.800 3.0e-05
astrocytoma 1.100 1.3e-02
atypical teratoid / rhabdoid tumor 1.100 1.8e-03
medulloblastoma, large-cell 1.700 1.0e-04
primitive neuroectodermal tumor 1.300 8.7e-03
pancreatic ductal adenocarcinoma liver m... 1.307 5.5e-03
intraductal papillary-mucinous carcinoma... 1.100 1.3e-03
aldosterone-producing adenoma -1.007 1.1e-02
subependymal giant cell astrocytoma -1.451 2.6e-02
spina bifida -1.115 3.5e-02
ovarian cancer -1.700 8.7e-07

Gene RIF (48)

PMID Text
26919393 Expression of several genes within the CELF1 locus, including MTCH2, were highly correlated with one another and were associated with Alzheimer's disease status.
26728670 High expression of CUGBP1 is associated with recurrence in lung adenocarcinoma.
26531141 CUG-BP1 affected the calcium release activity in single myofibers and the extent of atrophy was significantly reduced upon gene silencing of CUG-BP1 in atrophic muscle.
26498364 these data provided a comprehensive view of the CELF1 mRNA regulatory network in oral cancer
26491048 CUGBP1 and HuR negate each other's effects in regulating E-cadherin translation by altering the recruitment of E-cadherin mRNA to PBs and play important roles in the regulation of intestinal barrier integrity.
26249002 CELF1 dysfunction in malignant T cells led to the up-regulation of a subset of GRE-containing transcripts that promote cell growth and down-regulation of another subset that suppress cell growth
26234674 forced expression of miR-214-3p enhances the sensitivity of esophageal cancer cells to cisplatin-induced apoptosis. This effect is abrogated with rescue expression of survivin or CUG-BP1
26164657 Celf1 has a role in vegetal RNA localization during Xenopus oogenesis
26130707 The results indicate that the cellular level of miR-122 is determined by the balance between the opposing effects of GLD-2 and PARN/CUGBP1 on the metabolism of its 3'-terminus.
25701464 CUGBP1 promotes cell proliferation and suppresses apoptosis via down-regulating C-EBPalpha in human non-small cell lung cancers.
25619475 These results demonstrate the importance of CUGBP1 in the biological and pathological functions of NSCLC and indicate its potential as a therapeutic target for NSCLC.
25403273 The result is consistent with the hypothesis that MBNL proteins are trapped by expanded CUG repeats and inactivated in myotonic dystrophy type 1 (DM1) and that CELF1 is activated in DM1.
25123787 Data suggest a model for RNA binding protein CELF1/CUGBP1-mediated regulation of alternative polyadenylation (APA).
25077823 CUGBP1 has a critical role in modulating cell growth and apoptosis
24818870 the size and the number of colonies formed in gastric cancer MGC-803 cells were markedly reduced in the absence of CUGBP1
24788522 The Alzheimer's disease single nucleotide polymorphism rs10838725 (pAD = 1.1 x 10(-08)) at the locus CELF1 is also genome-wide significant for obesity.
24502807 CUGBP1 was expressed in 85.7% hepatocellular carcinoma specimens compared with 50% in normal liver specimens. CUGBP1 silencing remarkably decreased the proliferation of HepG2 cells.
24376746 CUGBP1 seems to play a role in classic DM1 but not in DM2
23359188 High CUGBP1 expression is associated with non-small cell lung cancer.
23324604 CELF1 depletion induces apoptosis in tumor cells, but not in normal cells.
23155001 CUGBP1 represses occludin translation by increasing occludin mRNA recruitment to P-bodies.
22982313 The results suggest that CUG-BP1 binds to nucleotides 51-100 of the human albumin 3'UTR. In human cells CUG-BP1 binding may thus play a role in regulation of albumin expression and, additionally, it may have a function in post-transcriptional control in CHO cells.
22646166 CUG-BP1 is overexpressed in oesophageal cancer cell lines and human oesophageal cancer specimens. CUG-BP1 associates with the 3'-untranslated region of survivin mRNA.
22355723 study suggests that regulation of CUGBP1 and MBNL1 is essential for accurate control of destabilization of a broad spectrum of mRNAs as well as of alternative splicing events
22117072 CUGBP1 binding to certain GRE-containing target transcripts decreased following T cell activation through activation-dependent phosphorylation of CUGBP1.
21637851 Stress granules component CUGBP1 was identified as a factor required for p21 mRNA stabilization.
21508681 CUG-binding protein represses translation of p27Kip1 mRNA through its internal ribosomal entry site
20947024 Data show that crystal structures of CUGBP1 RRM1 and tandem RRM1/2 domains bound to RNAs containing tandem UGU(U/G) elements.
20603324 Overexpression of CUGBP1 in mouse skeletal muscle reproduces features of myotonic dystrophy type 1.
20547756 identified 613 putative mRNA targets of CUGBP1 and found that the UGUUUGUUUGU GU-rich elements (GREs) sequence and a GU-repeat sequence were both highly enriched in the 3' UTRs of these targets
20227387 CUGBP1 directly controls CD9 expression.
20051426 These results strongly support a role for CUGBP1 up-regulation in myotonic dystrophy type 1 pathogenesis.
19553194 This study revealed the unique mechanism that enables the CUG-BP1 RNA-recognition motif 3 to discriminate the short RNA segment from other sequences.
19106619 CUG-BP1 and HuR act as factors that bind to the SBP2 3' UTR, which suggests that TTR-RBPs play a role in the regulation of SBP2
19047369 SRp20, SF2/ASF, and CUG-BP1 act antagonistically to regulate IR alternative splicing in vivo and that the relative ratios of SRp20 and SF2/ASF to CUG-BP1 in different cells determine the degree of exon inclusion.
18570922 Results show that ectopic expression of cyclin D3 corrects differentiation of DM1 myoblasts through activation of CUGBP1.
18243120 the GRE mediates coordinated mRNA decay by binding to CUGBP1.
18164289 These results demonstrate the dynamic behavior of CUGBP-1 during stress response and that the linker region, in concert with RRMs, plays a significant role in defining its subcellular localization and dynamics.
18039683 CUG-BP1 specifically recognized UG repeats, probably through cooperative binding of RNA recognition motifs at both ends of the protein.
17936705 Data show that expression of DMPK-CUG-repeat RNA results in hyperphosphorylation and stabilization of CUGBP1, and suggest that inappropriate activation of the PKC pathway contributes to the pathogenic effects of a noncoding RNA.
17854664 Insertional disruption of the CUGBP1 gene is associated with leukemogenesis
17531403 transcription of Cugbp1 gene in muscle is regulated by myogenin and E proteins
16946708 coordinated physical and functional interactions between hnRNP H, CUG-BP1 and MBNL1 dictate IR splicing in normal and DM1 myoblasts
16601207 CUG-BP, therefore, is the first RNA-binding protein shown to directly recruit a deadenylase to an RNA substrate.CUG-BP interacts with PARN in extracts by coimmunoprecipitation, and this interaction can be recapitulated using recombinant proteins
15099703 The results of this study suggest that the CUG expansion may bind to complementary sequences within the CUGBP1 mRNA and that this molecular interaction may affect CUGBP1 mRNA expression in DM1.
15082764 Data show that epidermal growth factor receptor signaling results in phosphorylation of CUG-BP1, and leads to increased binding of CUG-BP1 to CCAAT/enhancer binding protein beta (C/EBP beta) mRNA and elevated expression of the C/EBPbeta LIP isoform.
12799066 CUG-BP and Xenopus EDEN-BP have very similar RNA-binding specificities; it is suggested that the CUG expansion associated with Type 1 myotonic dystrophy can affect the function of CUG-BP, leading to a trans-dominant effect on normal RNA processing
11564876 CUGBP1 induces the translation of p21 via binding to a GC-rich sequence located within the 5' region of p21 mRNA. Alterations in the activity of CUGBP1 causes disruption of p21-dependent control of cell cycle arrest.

AA Sequence

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK      1 - 70
AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL     71 - 140
RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA    141 - 210
ASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSG    211 - 280
TNALTTSSSPLSVLTSSGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSN    281 - 350
GTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM    351 - 420
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY        421 - 486
//

Text Mined References (82)

PMID Year Title
26919393 2016 Alzheimer's Disease Risk Polymorphisms Regulate Gene Expression in the ZCWPW1 and the CELF1 Loci.
26728670 2015 Prognostic impact of CUG-binding protein 1 expression and vascular invasion after radical surgery for stage IB nonsmall cell lung cancer.
26531141 2015 CUG-BP1 regulates RyR1 ASI alternative splicing in skeletal muscle atrophy.
26498364 2015 RNA-binding protein CELF1 promotes tumor growth and alters gene expression in oral squamous cell carcinoma.
26491048 2016 CUGBP1 and HuR regulate E-cadherin translation by altering recruitment of E-cadherin mRNA to processing bodies and modulate epithelial barrier function.
26249002 2015 Altered CELF1 binding to target transcripts in malignant T cells.
26234674 2016 Overexpression of miR-214-3p in esophageal squamous cancer cells enhances sensitivity to cisplatin by targeting survivin directly and indirectly through CUG-BP1.
26164657 2015 A novel role for Celf1 in vegetal RNA localization during Xenopus oogenesis.
26130707 2015 Destabilization of microRNAs in human cells by 3' deadenylation mediated by PARN and CUGBP1.
25701464 2015 CUGBP1 promotes cell proliferation and suppresses apoptosis via down-regulating C/EBP? in human non-small cell lung cancers.
25619475 2015 Overexpression of CUGBP1 is associated with the progression of non-small cell lung cancer.
25403273 2015 ABLIM1 splicing is abnormal in skeletal muscle of patients with DM1 and regulated by MBNL, CELF and PTBP1.
25123787 2014 Alternative polyadenylation regulates CELF1/CUGBP1 target transcripts following T cell activation.
25077823 2014 Knockdown of CUG-binding protein 1 induces apoptosis of human laryngeal cancer cells.
24818870 2014 Lentivirus-mediated knockdown of CUGBP1 suppresses gastric cancer cell proliferation in vitro.
24788522 2014 Genetic variation at the CELF1 (CUGBP, elav-like family member 1 gene) locus is genome-wide associated with Alzheimer's disease and obesity.
24502807 2014 Suppression of CUGBP1 inhibits growth of hepatocellular carcinoma cells.
24376746 2013 Overexpression of CUGBP1 in skeletal muscle from adult classic myotonic dystrophy type 1 but not from myotonic dystrophy type 2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23359188 2013 CUG-binding protein 1 (CUGBP1) expression and prognosis of non-small cell lung cancer.
23324604 2013 Overexpression of RNA-binding protein CELF1 prevents apoptosis and destabilizes pro-apoptotic mRNAs in oral cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23155001 2013 Competitive binding of CUGBP1 and HuR to occludin mRNA controls its translation and modulates epithelial barrier function.
22982313 2012 CUG binding protein 1 binds to a specific region within the human albumin 3' untranslated region.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22646166 2012 The RNA-binding protein CUG-BP1 increases survivin expression in oesophageal cancer cells through enhanced mRNA stability.
22355723 2012 CUGBP1 and MBNL1 preferentially bind to 3' UTRs and facilitate mRNA decay.
22117072 2012 Regulation of CUG-binding protein 1 (CUGBP1) binding to target transcripts upon T cell activation.
21637851 2011 p21(WAF1/CIP1) upregulation through the stress granule-associated protein CUGBP1 confers resistance to bortezomib-mediated apoptosis.
21508681 CUG-binding protein represses translation of p27Kip1 mRNA through its internal ribosomal entry site.
21269460 2011 Initial characterization of the human central proteome.
20947024 2010 Structural insights into RNA recognition by the alternate-splicing regulator CUG-binding protein 1.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20603324 2010 CUGBP1 overexpression in mouse skeletal muscle reproduces features of myotonic dystrophy type 1.
20547756 2010 Analysis of CUGBP1 targets identifies GU-repeat sequences that mediate rapid mRNA decay.
20227387 2010 Chromosome wide analysis of CUGBP1 binding sites identifies the tetraspanin CD9 mRNA as a target for CUGBP1-mediated down-regulation.
20051426 2010 Heart-specific overexpression of CUGBP1 reproduces functional and molecular abnormalities of myotonic dystrophy type 1.
19946888 2010 Defining the membrane proteome of NK cells.
19553194 2009 Structural basis for the sequence-specific RNA-recognition mechanism of human CUG-BP1 RRM3.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19106619 Known turnover and translation regulatory RNA-binding proteins interact with the 3' UTR of SECIS-binding protein 2.
19047369 2009 SRp20 and CUG-BP1 modulate insulin receptor exon 11 alternative splicing.
18570922 2008 Ectopic expression of cyclin D3 corrects differentiation of DM1 myoblasts through activation of RNA CUG-binding protein, CUGBP1.
18243120 2008 Conserved GU-rich elements mediate mRNA decay by binding to CUG-binding protein 1.
18164289 2008 Dual localization of the RNA binding protein CUGBP-1 to stress granule and perinucleolar compartment.
18039683 2008 Quantitative analysis of CUG-BP1 binding to RNA repeats.
17936705 2007 Increased steady-state levels of CUGBP1 in myotonic dystrophy 1 are due to PKC-mediated hyperphosphorylation.
17854664 2007 C/EBPbeta suppression by interruption of CUGBP1 resulting from a complex rearrangement of MLL.
17531403 2007 Regulation of the promoter of CUG triplet repeat binding protein, Cugbp1, during myogenesis.
16946708 2006 Interaction of muscleblind, CUG-BP1 and hnRNP H proteins in DM1-associated aberrant IR splicing.
16862542 2006 ETR-3 represses Tau exons 2/3 inclusion, a splicing event abnormally enhanced in myotonic dystrophy type I.
16601207 2006 CUG-BP binds to RNA substrates and recruits PARN deadenylase.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15756469 2004 (1)H, (15)N and (13)C chemical shift assignments of RNA repeats binding protein -- CUGBP1ab.
15546872 2005 MBNL1 is the primary determinant of focus formation and aberrant insulin receptor splicing in DM1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15099703 2004 Altered expression of CUG binding protein 1 mRNA in myotonic dystrophy 1: possible RNA-RNA interaction.
15082764 2004 Epidermal growth factor receptor stimulation activates the RNA binding protein CUG-BP1 and increases expression of C/EBPbeta-LIP in mammary epithelial cells.
14759258 2004 An unappreciated role for RNA surveillance.
14726956 2004 Competition of CUGBP1 and calreticulin for the regulation of p21 translation determines cell fate.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12799066 A functional deadenylation assay identifies human CUG-BP as a deadenylation factor.
12649496 2003 Antagonistic regulation of alpha-actinin alternative splicing by CELF proteins and polypyrimidine tract binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707455 2002 c-Jun ARE targets mRNA deadenylation by an EDEN-BP (embryo deadenylation element-binding protein)-dependent pathway.
11686919 2001 Coexpression of the CUG-binding protein reduces DM protein kinase expression in COS cells.
11564876 2001 Molecular basis for impaired muscle differentiation in myotonic dystrophy.
11158314 2001 The CELF family of RNA binding proteins is implicated in cell-specific and developmentally regulated alternative splicing.
11124939 2001 RNA CUG repeats sequester CUGBP1 and alter protein levels and activity of CUGBP1.
10893231 2000 A family of human RNA-binding proteins related to the Drosophila Bruno translational regulator.
10536163 1999 CUG repeat binding protein (CUGBP1) interacts with the 5' region of C/EBPbeta mRNA and regulates translation of C/EBPbeta isoforms.
10446244 1999 Visualization of double-stranded RNAs from the myotonic dystrophy protein kinase gene and interactions with CUG-binding protein.
9371827 1997 Altered phosphorylation and intracellular distribution of a (CUG)n triplet repeat RNA-binding protein in patients with myotonic dystrophy and in myotonin protein kinase knockout mice.
8948631 1996 Identification of a (CUG)n triplet repeat RNA-binding protein and its expression in myotonic dystrophy.
8912635 1996 Identification of two nuclear proteins which bind to RNA CUG repeats: significance for myotonic dystrophy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8789448 1996 Novel proteins with binding specificity for DNA CTG repeats and RNA CUG repeats: implications for myotonic dystrophy.