Property Summary

NCBI Gene PubMed Count 28
PubMed Score 8.19
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.098 3.3e-02
malignant mesothelioma 1.600 2.4e-06
osteosarcoma -1.161 4.6e-03
glioblastoma 1.900 2.8e-03
adrenocortical carcinoma 1.093 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.400 4.6e-03
sonic hedgehog group medulloblastoma 1.100 1.3e-03
non primary Sjogren syndrome sicca 1.100 2.9e-02
ovarian cancer 1.700 3.4e-05

Synonym

Accession P53567 B2R946 Q5U052 C/EBP gamma
Symbols GPE1BP
IG/EBP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (11)

PMID Text
25669928 These findings suggest that CEBPG may play an oncogenic role in BCP-ALL and relies on a mechanism different from CEBPA.
24658403 HIV-1 Tat-mediated upregulation of CCL5 involves JAK2/3, AKT2/3, p38delta, NF-kappaB (p65/p50), C/EBP alpha/gamma, and AP-1 proteins
24244375 HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-kappaB, AP-1, C/EBPalpha and C/EBPgamma transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways
24244375 HIV-1 Tat-mediated upregulation of CCL5 involves JAK2/3, AKT2/3, p38delta, NF-kappaB (p65/p50), C/EBP alpha/gamma, and AP-1 proteins
23775115 High CEBPG expression correlated with poorer clinical prognoses in several human cancers, and C/EBP gamma depletion decreased proliferation and induced senescence in lung tumor cells.
23160200 CEBPG mediates the myeloid differentiation arrest induced by CEBPA deficiency in acute myeloid leukemia.
22437320 C/EBPgamma positively regulates wound repair both in vitro and in vivo, at least in part, by affecting EGFR signaling.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17893230 CEBPG regulates ERCC5 expression and this regulation is modified by E2F1/YY1 interactions.
16255782 CEBPG is the transcription factor primarily responsible for regulating transcription of key antioxidant and DNA repair genes in non-bronchogenic carcinoma individuals
12618752 Ig/EBP (C/EBPgamma)is constitutively multiubiquitinated & then degraded by the proteasome. Ubiquitination and degradation are suppressed by forming dimers through the leucine zipper domains.

AA Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRE      1 - 70
RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTEN     71 - 140
TTADGDNAGQ                                                                141 - 150
//

Text Mined References (30)

PMID Year Title
25669928 2015 B-cell precursor acute lymphoblastic leukemia with isolated t(14;19)(q32;q13) abnormality involving the CEBPG gene.
25416956 2014 A proteome-scale map of the human interactome network.
24244375 2013 HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-?B, AP-1, C/EBP? and C/EBP? transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways.
23775115 2013 C/EBP? suppresses senescence and inflammatory gene expression by heterodimerizing with C/EBP?.
23160200 2012 C/EBP? deregulation results in differentiation arrest in acute myeloid leukemia.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22437320 2012 C/EBP? regulates wound repair and EGF receptor signaling.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17893230 2007 CEBPG regulates ERCC5/XPG expression in human bronchial epithelial cells and this regulation is modified by E2F1/YY1 interactions.
16255782 2005 CEBPG transcription factor correlates with antioxidant and DNA repair genes in normal bronchial epithelial cells but not in individuals with bronchogenic carcinoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15833715 2005 C/EBPdelta and C/EBPgamma bind the CCAAT-box in the human beta-globin promoter and modulate the activity of the CACC-box binding protein, EKLF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12618752 2003 C/EBP family transcription factors are degraded by the proteasome but stabilized by forming dimer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177065 2002 C/EBP gamma has a stimulatory role on the IL-6 and IL-8 promoters.
8628277 1996 Fos-Jun dimerization promotes interaction of the basic region with TFIIE-34 and TFIIF.
8089482 1994 Activation of the Ig germ-line gamma 1 promoter. Involvement of C/enhancer-binding protein transcription factors and their possible interaction with an NF-IL-4 site.
7665092 1995 Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.
7501458 1995 Ig/EBP (C/EBP gamma) is a transdominant negative inhibitor of C/EBP family transcriptional activators.
1884998 1991 A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro.
1709121 1991 Molecular cloning of cDNA and a chromosomal gene encoding GPE1-BP, a nuclear protein which binds to granulocyte colony-stimulating factor promoter element 1.
1377818 1992 Molecular cloning of two C/EBP-related proteins that bind to the promoter and the enhancer of the alpha 1-fetoprotein gene. Further analysis of C/EBP beta and C/EBP gamma.
1371974 1992 cDNA clones encoding leucine-zipper proteins which interact with G-CSF gene promoter element 1-binding protein.